4LV7


Conserved Protein Domain Family
Ins_P5_2-kin

?
pfam06090: Ins_P5_2-kin 
Click on image for an interactive view with Cn3D
Inositol-pentakisphosphate 2-kinase
This is a family of inositol-pentakisphosphate 2-kinases (EC 2.7.1.158) (also known as inositol 1,3,4,5,6-pentakisphosphate 2-kinase, Ins(1,3,4,5,6)P5 2-kinase) and InsP5 2-kinase). This enzyme phosphorylates Ins(1,3,4,5,6)P5 to form Ins(1,2,3,4,5,6)P6 (also known as InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, nonhomologous end-joining, endocytosis and ion channel regulation.
Statistics
?
PSSM-Id: 399231
Aligned: 85 rows
Threshold Bit Score: 119.468
Threshold Setting Gi: 122161679
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LV7_A        49 YRGEGGANLVLAYAG---SSPlfv-------------------------------------gkVIRIQKARRndkaikns 88  thale cress
EON65624      53 diyQGGANIVYKLDS---LGSddekya-------------------------------plrnrVLRVRKSVD-------- 90  Coniosporium ap...
Q0UF80        83 YLSQGGANVIFKIHS---WPqkpsqqdqpflfvdakl----------astkatpihslqlvdkVLRINKGLL-------- 141 Parastagonospor...
XP_003839579  59 YLNKGAANAVFTIHP---SSVviiekvsskpifqlvielyk---tdrkcltaqplsreklagrVLRVPRGKD-------- 124 Leptosphaeria m...
XP_001930678  43 YLNKGAANVIFQIHA---Wqhassatsflfaelrqed---------dpsqmatplhrqhfmhrVVRVPRGGA-------- 102 Pyrenophora tri...
ERT01862      65 FVGEGSANAVFCVVPandVDDgsdctpdaqdaadardtqsvkavkpvkdanpkmahagplsthLLRIPKAGP-------- 136 Sporothrix sche...
EPE10016      63 YIGEGSANAVFCVTPkkkNLSkssskssapgshni---------------psndsdagslsthLLRIPKAGP-------- 119 Ophiostoma pice...
EGS20648      27 FVGEGASNVVFEVRV---PPskrgsiss---------------------------klfegtgnLLRVPKAGT-------- 68  Chaetomium ther...
XP_003344264  21 FIGEGAANIVFEVIF---PHEdvtitqddgd----------------------skilnilqgkLLRVPKANT-------- 67  Sordaria macros...
XP_957829     21 FIGEGAANIVFEVVF---PEEdittqddgds-----------------------qildilhgkLLRVPKANT-------- 66  Neurospora cras...
4LV7_A        89 ngvvsvltsdeqhlwrennelISSPNKCVLEQRYVQNVIIPLLG----------------------------------PK 134 thale cress
EON65624      91 ------------------------DTTTQQIAICFSGFISKLLE----------------------------------PR 112 Coniosporium ap...
Q0UF80       142 -----------------------KTLRCEEVISGFYGHVRPLFAaggvttivgpay----------tqlpikmhdrdyTE 188 Parastagonospor...
XP_003839579 125 -----------------------KTLSGDKILSSFNLLIKPLFQpaetghtaaqmsgfridtngnviqatlrsmqgdlCQ 181 Leptosphaeria m...
XP_001930678 103 -----------------------KHLTSTEIIHGFEHAIRPLFLpgtyetvgnlnv----------pststvqltqdlTK 149 Pyrenophora tri...
ERT01862     137 ---------------------GVSPTTCLEHHVFYSSVLRPLLG----------------------------------AE 161 Sporothrix sche...
EPE10016     120 ---------------------GVGAGTCLDHHAYYSSVLRPLIG----------------------------------TE 144 Ophiostoma pice...
EGS20648      69 -----------------------KAYSYEDLHAYWETVVKPLFE----------------------------------PQ 91  Chaetomium ther...
XP_003344264  68 -----------------------KAFPHPQILQYWESSISPLFDn--------------------------------pQE 92  Sordaria macros...
XP_957829     67 -----------------------KAFPHPEILQYWESSISPLFDn--------------------------------pQE 91  Neurospora cras...
4LV7_A       135 HVDAGVRVS--VSKEFLECVDKKV------------TKQ--RPLWRVNAa---------------NVDTSHdCALILNDH 183 thale cress
EON65624     113 FLVEMKLVH--LTEDFIASLNLDL-----------------------HQlelsgwrstkhvgarvKPDA---WGLLLTDM 164 Coniosporium ap...
Q0UF80       189 YLMEHQGVI--LYSSVMVNLTSKSdaigverglgsaQQLltSQR----------------------------WGILLPDM 238 Parastagonospor...
XP_003839579 182 HLMDHKGII--LFPHAVCTLRSLAnkdv----fvgpQDGpsEMC----------------------------WAILLEDM 227 Leptosphaeria m...
XP_001930678 150 HLMYHEGVL--LLPEVMQHLYNSAetg-------tfTSTkpRTL----------------------------WGILLPDM 192 Pyrenophora tri...
ERT01862     162 WLVGQHLVQgiVSTGVHAVLDGLL------------RDLd---rSHRRRpdwv----------gtgVAANVdVALLVEDM 216 Sporothrix sche...
EPE10016     145 WLVGQHLVQgiISRGVQSTLNDLL------------ENLd---rSGRRRpdwv----------gtrISPDVdVALLVEDM 199 Ophiostoma pice...
EGS20648      92 NLVQHQLILl-gGEAVIRRLNSIL------------EKEd-----aTRRadfr----------gsrVAMAK-YGMLIEDM 142 Chaetomium ther...
XP_003344264  93 DLVQQYLVR--LDNSIVSQLNEVL------------GTEd-----vQRRadfq----------gtkVAEAE-YGMLVEDM 142 Sordaria macros...
XP_957829     92 DLVQQYLIR--LNNSVVSQLNAIL------------ENEd-----aQRRadfq----------gtkVAEAE-YGMLVEDM 141 Neurospora cras...
4LV7_A       184 SLFSQGITSG-GDCISVEIKPKCgF--LPTSRFIGkenilktSVSRFKMHQLLKleyie--------------------- 239 thale cress
EON65624     165 TSDGTLR-KEgGGAYAIEFKPKW-LsqSPNAPPLS-------RRCRTCAIRAQRdsekqsqgqsd--------------- 220 Coniosporium ap...
Q0UF80       239 SPTPGN-------SVTIELKPKW-LaqSPTAPSKA-------IRCRTCALQVLKpkd----------------------- 280 Parastagonospor...
XP_003839579 228 SPVPNK-------SVMLEIKPKW-LlqSPDAPAGA-------IRCRTCAMQTLLpkh----------------------- 269 Leptosphaeria m...
XP_001930678 193 SPIPGQ-------SITLEVKPKW-LaqSPNAPSKA-------LRCRTCAMQVSVpkn----------------------- 234 Pyrenophora tri...
ERT01862     217 TSACKRAASSgSTTTTIQCKPKW-LvqSPSAPAGA-------RRCRTCALSAASaaasprlpgkvttangatkgagngha 288 Sporothrix sche...
EPE10016     200 TLACNKS-LHpSTTTTVQFKPKW-LvqSPSAPAGA-------RRCRTCALSAASaspstssstkgngrknsng-pkttqg 269 Ophiostoma pice...
EGS20648     143 RQRHP-------DDLTFEFKPKW-LaqSPSAPPTA-------TRCRNCAREALKrhanpdr------------------- 188 Chaetomium ther...
XP_003344264 143 RKKSP-------TDLLLEFKPKW-LtpSPTAPSTA-------TRCRNCAREAYRlhkslrsasssrp------------s 195 Sordaria macros...
XP_957829    142 RKKSP-------LDFLLEFKPKW-LtpSPSAPSTA-------TRCRNCAREAYRlhkslrsassd--------------- 191 Neurospora cras...
4LV7_A       240 -------iseesEYDPLD-L------F-SGSKERVLEAIKALY----------------------------S--TPQNNF 274 thale cress
EON65624     221 --rpavagaakaTFCPLAlL--------SDDRATLATIARSLFattdyaavd---------------------------- 262 Coniosporium ap...
Q0UF80       281 ---------pskYLCPLQlL--------NGNFDVVNKWVLSRVaeqaagpt----------------------------- 314 Parastagonospor...
XP_003839579 270 ---------ranYICPLLlL--------HGTPNHIRPWLSTRIskllptat----------------------------- 303 Leptosphaeria m...
XP_001930678 235 ---------rdaYVCPLQlL--------HGNAAILRPWARTTIarqfpasdr---------------------------- 269 Pyrenophora tri...
ERT01862     289 dwatkgdkahkiKPCPMV-LvadpptT-PQEEAELEAALWDYVckhlgsavsfppsspfatpfsastppvaLl------- 359 Sporothrix sche...
EPE10016     270 rsssgpekshkiKPCPIV-LvadppkT-AAEEADLDAALWEYVyqhlgsavssqssspnsstplspsttflLl------- 340 Ophiostoma pice...
EGS20648     189 ------qpkssaILCPLDfR------TcATSPISLANVLNHLTprvhkptanahppsvslnghspasprptP-------- 248 Chaetomium ther...
XP_003344264 196 sdqgsaaltensIFCPLEyL------AaQSSPSSLARVIESMNlsatsvseetapatkenpvgaqpavsldGd----eGI 265 Sordaria macros...
XP_957829    192 -qnsscalshepPFCPLEyL------AaQSSPCSLARVIASMNlsaisasldtkpatrenpvgvqpavsldGedDGRPGM 264 Neurospora cras...
4LV7_A       275 RVFLNgslilggsgestgrtspeigyafedalkgfiqsedghrteCfLQLVSDAVYGS----GVLDRLLEIQK------- 343 thale cress
EON65624     263 --------------------------------------lqdqhrtffTTRFVDFFTAQgdglRLLRRLQFLQ-------- 296 Coniosporium ap...
Q0UF80       315 --------------------------------------qdtkrnsAiSHEITSYLMKGpg-kSLLEHLRVLQ-------- 347 Parastagonospor...
XP_003839579 304 --------------------------------------taprlvqGiTEQVLAYLTTGvg-rTLLQHLAFLQ-------- 336 Leptosphaeria m...
XP_001930678 270 ------------------------------------npssqtvlaAmTEGLLSYLTAGeg-sTLLRHLLKLQ-------- 304 Pyrenophora tri...
ERT01862     360 ---------------------------------------------KaRPAIIQWLRTT----DLFRRIAAIQ-------- 382 Sporothrix sche...
EPE10016     341 ---------------------------------------------KtRPAIIRWMRTT----NLFRRIAAIQ-------- 363 Ophiostoma pice...
EGS20648     249 ---------------------------------------------SqSARLRHWLQTn----TLLPRLRQAQLandglgp 279 Chaetomium ther...
XP_003344264 266 EEVDE----------------------------------------RyRVALVRWLQTn----SLLPKLRDAQ-------- 293 Sordaria macros...
XP_957829    265 DQVDE----------------------------------------RyRVALVHWLQSn----SLLPKLRDAQ-------- 292 Neurospora cras...
4LV7_A       344 --LDKLDIEGAIHCYYDIinqpcp-ickegRPLeaelslHALPLDESLKIVKEYLIAATAKDCSIMISFqsrnawdsePS 420 thale cress
EON65624     297 ---QRLDPYGILATGI-----------------------SPLPEHITLIHLKRFQLAMTLRDCSLLMKI----------- 339 Coniosporium ap...
Q0UF80       348 ---VSLDHHGILNGNKIGspkkel-hnmfeHNV---------------------RLAMTLRDCSLYIRI----------- 391 Parastagonospor...
XP_003839579 337 ---SKLDPYGVL----WQnnmdt--snainFNL---------------------RAAMSLRDCSLFIKA----------- 375 Leptosphaeria m...
XP_001930678 305 ---STLDPFGVL----CRprdsfqgaalfeHNL---------------------RLAMTLRDCSLFIKM----------- 345 Pyrenophora tri...
ERT01862     383 ---AEYDPHGAIAVGL-----------------------------ETGDALDRLQTAMTLRDCTCFLRV---------TT 421 Sporothrix sche...
EPE10016     364 ---AEHDPHGALAVDL----------------------------ADDVTSLDRLQTAMTLRDCTCFLRV----------- 401 Ophiostoma pice...
EGS20648     280 lgADASDPH--------------------------------------------FQLAMTLRDCTCFVRV----------- 304 Chaetomium ther...
XP_003344264 294 ---ERLDPA-----------------------------------PEGTTDREELALAMTLRDCTCFVRI----------- 324 Sordaria macros...
XP_957829    293 ---ESLDPA-----------------------------------PEGTSDQEKLALAMTLRDCTCFVRI----------- 323 Neurospora cras...
4LV7_A       421 GDYVSLKPTNQTFDYKVHFIDLSLKPLK-RMESYYKLDKK 459 thale cress
EON65624     340 -------PLSATEPVEARLADLDVKSSKrKLEEWRLKERs 372 Coniosporium apollinis CBS 100218
Q0UF80       392 ---AYSKDGAVPSSIECKLGDLDFKSAD-KMDDWAAKETE 427 Parastagonospora nodorum SN15
XP_003839579 376 ---EYDAATGIPSNIISKLGDLDFKSEE-KTLDWAEKEKR 411 Leptosphaeria maculans JN3
XP_001930678 346 ---SYSPKGLV--SIESKLGDLDFKSAV-KMVDWSEKERQ 379 Pyrenophora tritici-repentis Pt-1C-BFP
ERT01862     422 GLTGDASLSAAPVSVSAKLGDLDRKDGRlKLARWQAQERT 461 Sporothrix schenckii ATCC 58251
EPE10016     402 ----TVSESSSEVSISAKLGDLDRKDGRrKLARWQAQERA 437 Ophiostoma piceae UAMH 11346
EGS20648     305 -------PANPELPIEAKLADLDKKNWMaKMEYWRAMEQK 337 Chaetomium thermophilum var. thermophilum DSM 1495
XP_003344264 325 -----SEDSQGEVKVEAKLADLDKKNWKaKLEYWKGLEGE 359 Sordaria macrospora k-hell
XP_957829    324 -----SEDSKAGLKVEAKLADLDKKNWEaKLEYWKGMDEV 358 Neurospora crassa OR74A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap