6A9S


Conserved Protein Domain Family
Pox_A30L_A26L

?
pfam06086: Pox_A30L_A26L 
Click on image for an interactive view with Cn3D
Orthopoxvirus A26L/A30L protein
This family consists of several Orthopoxvirus A26L and A30L proteins. The Vaccinia A30L gene is regulated by a late promoter and encodes a protein of approximately 9 kDa. It is thought that the A30L protein is needed for vaccinia virus morphogenesis, specifically the association of the dense viroplasm with viral membranes.
Statistics
?
PSSM-Id: 399228
Aligned: 2 rows
Threshold Bit Score: 401.309
Threshold Setting Gi: 1685821645
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6A9S_A   2 ANIINLWNGIVPTVQDVNVASITAFKSXIDETWDKKIEANTCISRKHRNIIHEVIRDFXKAYPKXDENKKSPLGAPXQWL 81  Vaccinia virus WR
Q89489   2 VNIINLWNGIVPMVQDVNVASITAFKSMIDETWDKKIEANTCISRKHRNIIHEVIRDFMKAYPKMDENRKSPLGAPMQWL 81  Variola virus human/I...
6A9S_A  82 TQYYILKNEYHKTXLAYDNGSLNTKFKTLNIYXITNVGQYILYIVFCIISGKNHDGTPYIYDSEITSNDKNFINERIKYA 161 Vaccinia virus WR
Q89489  82 TQYYILKNEYYKTMLAYDNESLNTKFKTLNIYMITNVGQYILYIVFCIISGKNHNGTPYIYDSEITSNNKNLINDRIKYA 161 Variola virus human/I...
6A9S_A 162 CKQILHGQLTIALRIRNKFXFIGSPXYLWFNVNGSQVYHDIYDRNAGFHNKEIGRLLYA 220 Vaccinia virus WR
Q89489 162 CKQILHGQLTMALRIRNKFMFIGSPMYLWFNVNGSHVYHEIYDGNVGFHNKEIGRLLYA 220 Variola virus human/India/Ind3/1967
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap