Conserved Protein Domain Family
ArAE_1

?
pfam06081: ArAE_1 
Aromatic acid exporter family member 1
This family consists of bacterial proteins with three transmembrane regions that are purported to be aromatic acid exporters.
Statistics
?
PSSM-Id: 399224
Aligned: 26 rows
Threshold Bit Score: 147.696
Threshold Setting Gi: 81582058
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9KEB1                   1 MKLGARIFKTGLAVMLSLYLAIWLQFDSPVFAALTAAFAVQPSIYRTFQTILDQVQANVIGAIIAVIFAVTFGHEPFVIA 80  Bacil...
Q8ENS1                   5 SFIGSRVIKTGIAVLLTAYICEWIGWS-PVFAVITAIVTIEPTVSDSIRKGLIRFPASAIGAAYAVLFIALFGNSPVTYA 83  Ocean...
Q81PQ8                   8 nIIGGRVIKTGIAVFLTVLVCEFFNIP-TIFAVITAIVTIEPTATDSIKKGLVRFPASTIGSAYAMTFTFFLGHQALSYA 86  Bacil...
P71083                   1 MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIG 80  Bacil...
PRJNA212797:N288_05720   1 MKLGARILKTGIAIILSLFLSEIFNLPTPVFAGIAAIFAIQPTIYRSYLSVIEQIQGNIIGAVIAVVFVLVFGNNYFIVG 80  Bacil...
Q8Y6J8                   1 MKFGARILKTGIAITLALFIAQLCNSPSPSLAGISAVFAIQPSIYRSYRTILERAQGNVIGAIIAIIFGLYIGNDFILIG 80  Liste...
Q81YV2                   1 MKLGARILKTGIAITLALFACILLNLPSPVFAGISAIFAVQPSVYRSYLTALEQIQANVIGAVFAIAFATAFGHNPFIIG 80  Bacil...
Q5WIF0                   1 MRLGARILKTGLAVVLALYLANWLQFNPPTFAAIAAAFAIQPSLFRTLRTFSHQVQANLIGAIIGVLFVMTFGHAPFVVG 80  Bacil...
Q833N4                   1 MKIGLRTVKTAISAALAMIIAEKLGLLYAPSAGIISVLSVTSTKKTSVMTGIYRLLSLALATILAYICFTFLGFTAIAFG 80  Enter...
Q97G85                   2 RIIGLRTLKTALGAAIAIIIAEFLGLKYAAAAGIITILSVQNTKKTSIIIAFQRLASTLLALIISCIIFMIFGYNPISFG 81  Clost...
Q9KEB1                  81 VVIVITIALILKLKLDtSTISIALVTIIVIMESPVENFVDfATDRFLLIMLGVVSAFLVNLVF 143 Bacillus halodurans
Q8ENS1                  84 LSAVFTITTCFRLKLH-DGLLVATITSVAMVDVIHSNYVMeFFIRLFTTTIGLSVSTLVNMFL 145 Oceanobacillus iheyens...
Q81PQ8                  87 LAAMFTIVTCQKLRLH-AGTLVATLTAVAMIPITADHYFTaFLIRLATTSTGIIVSTVVNFFI 148 Bacillus anthracis
P71083                  81 LTAVIVITIMLKLKIE-HTISIALVTVIAILESAGDDFLMfALIRTSTVILGVLSSFIVNLVF 142 Bacillus subtilis subs...
PRJNA212797:N288_05720  81 LAAVIVIIINLKLKLE-KTIALSLVTLIAIMETPGDDFVQfAVIRFSTIMLGILSAFLVNLVF 142 Bacillus infantis NRRL...
Q8Y6J8                  81 VASIICVALLMQFRLE-NTIGLAVVTLIIVMDSPGNDFLEiALIRFGTIMLGLLAAFIVNLFF 142 Listeria monocytogenes
Q81YV2                  81 LTCILVIALTLQLRLE-NTISIALVTVIAIMEYQGEDFFSfALLRFATIMVGIIAASLVNLVF 142 Bacillus anthracis
Q5WIF0                  81 VVVMLSIAIFIKLKLEpAIIPTAIVTVIIIMESPSDNFLEfAAQRFILVLIGILAAFLVNLAF 143 Bacillus clausii KSM-K16
Q833N4                  81 IFLLLFIPAAVYFQLS-DGIVVSSVLVTHYLVEKNLSWAI-IGNEFLLMSIGVGLALLANSYM 141 Enterococcus faecalis
Q97G85                  82 VYLAIFIPLTVLFKLT-EGIAVSSVLVTHILVEKTISVFW-LKNELLLMVVGAGIAILLNTYM 142 Clostridium acetobutyl...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap