Conserved Protein Domain Family
DUF937

?
pfam06078: DUF937 
Bacterial protein of unknown function (DUF937)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399222
Aligned: 53 rows
Threshold Bit Score: 39.5423
Threshold Setting Gi: 81503280
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011801451   6 LGQILGSVLGNAQSGQqnp-----------------------------------mggGLGGGLGDLLGGMLGgnrgsaes 50  Polaromonas nap...
Q8XVR5        59 LFGSLGSLAGMLGGAG------------------------------------------ALGGLGGLLGQLTG-------- 88  Ralstonia solan...
Q9HXK1        53 LLGSLGSILGGAGGGA------------------------------------------ASGGLGGVLGDLLG-------- 82  Pseudomonas aer...
Q6NCJ5        27 MSKFTMAILALLVWKAykhmtsgqpqaapa---------------nqprpmpapppantGGGWGDFLK------------ 79  Rhodopseudomona...
CAL74587      28 MSPMTMAILALLAWKAvkhfsqngqqpnaapt---------pvpppqptnqggglggALGGGLGNILA------------ 86  Bradyrhizobium ...
EGP09816      30 MSPMTMAILALLAYKAvkhfggshsgaspadtapsaptplpgtttastgglggalggGLAGGLGDLMKGPLG-------- 101 Bradyrhizobiace...
WP_012561237  26 MSPITMAILALLAYKAvkhlsgstgtataptggs------stlpgsttaptgglptgGLSGGLGGLLQGNLG-------- 91  Oligotropha car...
Q21BV6        26 MSPITMAILALLAYKAvkhiggnnqpapaptnt-------rasvppagntvnawlpgSS-GGLGDLLK------------ 85  Rhodopseudomona...
Q6FA10        27 LGGILGSVLGQLGANQqpqnq--------------------------------gntqNTDRGLGGILGSVLSqfgagtas 74  Acinetobacter b...
WP_013107820  74 LDAVLGSLLGNNQQNT------------------------------------------SAGDLGNVLGAVLG-------- 103 Moraxella catar...
WP_011801451  51 tassgGGLGGgssglgnkgsalmllllplamqwvqrnGGIGAVLERFQNKGYSQQAASWvstgp--nealAPQAVNDVI- 127 Polaromonas nap...
Q8XVR5        89 -----GGGNTdhaav-----------------daaapGGVGPLQQILEQAGLGEQVRSWigngq--nlpvSGEQITQALg 144 Ralstonia solan...
Q9HXK1        83 -----GAAGGagqaapg--------------veagslGGLGGLFQMLQNAGLGDALNSWigggp--nqsvSAADISRVF- 140 Pseudomonas aer...
Q6NCJ5        80 -----GGLGGlvlgga---------------agsvlsGGLGDLLRQLQHNGLGDAANSWvghgp--nqqiGPSDLANAL- 136 Rhodopseudomona...
CAL74587      87 -----GGLGGllagga---------------agsvlsGGLGDLLHQFQEKGHGDAANSWvspge--nkqiSPGDLANAL- 143 Bradyrhizobium ...
EGP09816     102 -----GALGGllagga---------------agsvlsGGLNDLLKQFQDNGHTETANSWvangp--nkqiTPGDLASAL- 158 Bradyrhizobiace...
WP_012561237  92 -----GLLGGllagga---------------agsvlsGGLNDLLKQFQEAGHGDAANSWvspgs--nkpiTSDDLASAL- 148 Oligotropha car...
Q21BV6        86 -----GGLGGllagga---------------agsilsGGLGDLLRQFQQSGHGDAANSWvspgp--nrqiAPNDLATAL- 142 Rhodopseudomona...
Q6FA10        75 snttnRSGGGttqailiavv-------piilawiqkqGGLQGALDKLKNSGLGTQVQSWvdpqqsndhnvSTAEVEQLF- 146 Acinetobacter b...
WP_013107820 104 --------RGnvksagmnkstlllallpivltfiqknGGLSGVLSKFSNNGLQNKVQSWvnvdt-nndgiDADDIARLF- 173 Moraxella catar...
WP_011801451 128 GMDELSRLSQQLGVSQEEVSSGMAQILPEMVNQLTP 163 Polaromonas naphthalenivorans
Q8XVR5       145 GSGALSQLASTFGLNENEVASQLAEILPDAVNHLTP 180 Ralstonia solanacearum
Q9HXK1       141 GDGQLQQLADSAGVSQGEAAEHLSSLLPELVNKLTP 176 Pseudomonas aeruginosa
Q6NCJ5       137 GADQIDAMTRQTGMSRDELLNGLSRYLPDVVDQLTP 172 Rhodopseudomonas palustris
CAL74587     144 GADQIDQLTAQSGLSRDELLSGLSQYLPKVIDQLTP 179 Bradyrhizobium sp. ORS 278
EGP09816     159 GADQINTLSSQTGLSRDELLSGLAKQLPDIINQLTP 194 Bradyrhizobiaceae bacterium SG-6C
WP_012561237 149 GADQINTLTSQTGLSRNELLDGLAQQLPEFIHQLTP 184 Oligotropha carboxidovorans
Q21BV6       143 GADQIDSLTSQTGLSREDLLSGLSQHLPEVVDQLTP 178 Rhodopseudomonas palustris BisB18
Q6FA10       147 DENEVEQVAQQTQVPKQDVYGAISSVLPQIINALTP 182 Acinetobacter baylyi
WP_013107820 174 DHQDIENICQKTGASRLEVYQGIAELLPKVMDDLTP 209 Moraxella catarrhalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap