Conserved Protein Domain Family
DUF935

?
pfam06074: DUF935 
Protein of unknown function (DUF935)
This family consists of several bacterial proteins of unknown function as well as the Bacteriophage Mu gp29 protein.
Statistics
?
PSSM-Id: 399220
Aligned: 37 rows
Threshold Bit Score: 466.351
Threshold Setting Gi: 123551382
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012347274    4 KILDQYGKPIDLAAIR-EPQTEreasatggAARVGWLHREFD-AHPGRALTPARLNAILTQAE-----QGD-ITAQLELA 75  Leptothrix cho...
WP_021761115    3 TLYDHRGVPVSSRDLKeSQAEAvr-----rRSRLGGSAGLDTwTPARGALTARQLAGLLRAGG-----AGD-VAAQANLF 71  Desulfovibrio ...
jgi:Tgr7_1641   3 ALVDQHGRPIRRQELAgEVQTA----------TVAYLRREFA-DHPSRGLTPAKLARILEDAE-----QGD-LVAQARLG 65  Thioalkalivibr...
WP_012728966    2 sIVDIHGSPIRLER---EPQTEn-------DSMLGLLRRHYS-EHPTVGLTPGKAAAALLEAE-----LGN-MISQCELA 64  Tolumonas auensis
Q8EJ08          9 RILDATGRPFKVREAK-ELQTD--------DVRLAGLHRTFS-NHPSSGLTPASAASILLSAE-----QGD-LIAQCELA 72  Shewanella one...
Q30VX9         12 SVIDF---SSAADRAAlGEQLA-------------------TrRNALGGFDLGAALGWLPDPDpvlrkRGDsVHVLEDLM 69  Desulfovibrio ...
Q2NUR4         11 EFVSF-----AEPNKTlTEQIA----------------------SRSRSIDFFGLGMYLPNPDpilksQGRdIRIYREL- 62  Sodalis glossi...
Q7N1N0         11 EFINF-----SESKQSfTEQIA----------------------SRSRSIDFYSLGTYLPNPDtilkaQGRdIRVYREL- 62  Photorhabdus l...
Q6D0S9         11 EFVSF-----SEPKKSlSEQIA----------------------SRDRSMDFYGLGMYLPNPDpilkaQGKdIRIYREL- 62  Pectobacterium...
Q6QIC0         11 EFVTF-----GEPDKSlSSQIA----------------------TRARSIDFFALGMYLPNPDpvlkaLGKdIRVYREL- 62  Burkholderia v...
WP_012347274   76 DDMEERDGQIFSELAKRKTAVTTLEWDVEPPDDaSSAEQAMADQVRDWIKQIPNfeEDVLLELMDAVLKGYKPIEMW-WE 154 Leptothrix cho...
WP_021761115   72 DEMEEKDPHIGHLASIRKRAVSGRSWQMDAADD-SPKAAEIAGFCQTVLEALPL--RQAFRDALDATGKGFAALELY-WD 147 Desulfovibrio ...
jgi:Tgr7_1641  66 EDMEEKDAHLYAELSKRRRALLGLDWDLRPPEGaTERERRETSRIEALIRELDW--EAIVYDAAAAILYGYSCQEID-WE 142 Thioalkalivibr...
WP_012728966   65 EDMEEKDAHLQSELGKRRRSLLSVPWTIKPPRNpSAEEQRDADLLTELLEDFTWf-EDCIFDATDAILKGFSAQEFTgWE 143 Tolumonas auensis
Q8EJ08         73 EDIEEKDGHLFAELDKRKRALIGVDYYLEPPSNpTPQEKADTEYLQQMLEEGGWi-KSLIKSIADAILKGFSMHELA-WS 150 Shewanella one...
Q30VX9         70 ADDEVTQAIQSRKLKTLNRREYRFSPGAANGEEpTAQAERLCDDIVRDFEQLDM--DVLISGILDAPYFGMTPIELV-FV 146 Desulfovibrio ...
Q2NUR4         63 ----RTDPLVGGCIRRRKAAVKSLERGLER----GHAPARVFSFIRDMLDDLDL--SRIIGEMTDAVLYGYQPCEIM-WG 131 Sodalis glossi...
Q7N1N0         63 ----RTDPLVGGCIRRRKAGVKALERGVER----SNAPVRVFNFIRDMLADLDM--SRIIGEMHDAVLYGYQPCELM-WN 131 Photorhabdus l...
Q6D0S9         63 ----RTDPLVGGCIRRRKAAVKTLERGVDR----GSAPVRVFSFIRDMLTDMDM--SRIIGEMTDAVLYGYQPCEVM-WQ 131 Pectobacterium...
Q6QIC0         63 ----RADAHVGGCVRRRKAAVKALEWGLDR----GKAKSRVAKSIADVFADLDL--SRIVTEMLDAVLYGYQPMEIT-WG 131 Burkholderia v...
WP_012347274  155 LDQGTRQPR-FAPRPQRWLCIG-EDRNSLRLRDGASQy---GVPLQPYGWLLHVHKSRNGYLARGSLARVLAWPFLFKHY 229 Leptothrix cho...
WP_021761115  148 VSAGQAVPTrLEFVEQRRFGWLrLGNGALELGLAGDGslrePEPLWPFKWLVHRSQARSGVPWRGPLYRTLAWLYLFRNY 227 Desulfovibrio ...
jgi:Tgr7_1641 143 RSAGEWRPRaIDYRQPDWFMVQpEARDTLRLRSAGGQ----GEALRPWGWVVHVHKAKSGYLARGALTRVLAWPFLFRNF 218 Thioalkalivibr...
WP_012728966  144 QVEGLMLPKgLEWRDPAWFQTHpDDRNQLRLRDGTYE----GAVLNPFGWVVHNAKSKSGYLARTGLIRTLVWPFLFKNY 219 Tolumonas auensis
Q8EJ08        151 RELGEWFVEvPEYRDPSWFMTHpERRNELRLRDSTHE----GAELWPFGWIKHIHPAKSGYVSRSGLVRQLIWPFIFKNY 226 Shewanella one...
Q30VX9        147 PDGGRLRLVaADPKPVEWFAFDdDNRLMFRGEFFTQ-----ARPVHPYKFVLARHFPTYKNPYGLRLLSRCLWPVAFKRG 221 Desulfovibrio ...
Q2NUR4        132 RSVKSWAIAdIVGKPPEWFQFDnDNLLRFRAKDAGLE----GEPVPLNKFVVPRQDATYDNPYGFPDLSMCFWPVTFKKG 207 Sodalis glossi...
Q7N1N0        132 QN-QSWSVTdIVSKPPDWFHYDrDNQLRFRARDAGVE----GERVPLYKFVTPRQDATYDNPYGFPDLSMCFWPVTFKKG 206 Photorhabdus l...
Q6D0S9        132 RSGTSWHVSdIVGKPSDWFQFDtDNRLRFRSRDSGFE----GEAVPDYKFLVPRQDATYDNPYGFPDLSMCFWPVTFKKG 207 Pectobacterium...
Q6QIC0        132 KVGNYIVPIdVVGKPADWFVYDpENQLRFRSKDHWMQ----GEELPARKFLVPRQEATYLNPYGFPDLSMCFWPTTFKKG 207 Burkholderia v...
WP_012347274  230 AVRDLAEFLEIYGLPMRLGKYPAGASDDEKRKLLQAVVSIGHNAGGVIPASMAIDFQNAAQ--GNEAPFKTMWDGMDAVQ 307 Leptothrix cho...
WP_021761115  228 NLAGWARFVESYGIPTRLGRYPAGATETEQNTLLAAAQAISSEAAVIIPQGMQLELLETKFssAAKTPHEGFLDWTTRSI 307 Desulfovibrio ...
jgi:Tgr7_1641 219 SARDMAEFLEIYGLPLRLGRYPNGANEQEKATLMKAVVNIGHAAAGIVPDGMQVEFKEAAK--GQSDPFMAMIGWAERSV 296 Thioalkalivibr...
WP_012728966  220 SVRDLAEFLEIYGLPVRLGKYPEGATDKEKTTLLNAVLSIGHNAGGIIPRGMEIEFQNAAS--GQADPFVVMMDWCERSM 297 Tolumonas auensis
Q8EJ08        227 SVRDLAEFLEIYGLPLRIGQYPAGASDGEKRALLNAVMSIGHNAGGIMPKGMVMDFHSAAT--GQADPFELMMTWAEKTM 304 Shewanella one...
Q30VX9        222 GIEFWCRFTEKYGQPWLLGTARAGATQPEINRMAADLAAMVQDAVAVVPNGAKVEAVEFSAk-GGSQHLEFITHW-DKSI 299 Desulfovibrio ...
Q2NUR4        208 GMKFWVRFAEKYGSPWVIGKHPRGTAQGEIDLLLDSMEAMVEDAVAAIPDDSSIEIKEAAGkaDSSDIYQNLITLARSEI 287 Sodalis glossi...
Q7N1N0        207 GMKFWVRFAEKYGSPWVIGKHPRGTPQSEIDLLLDSMEAMIDDAVAAIPDDSSVEIKEAAGksDSSDIYQNLITVARSEI 286 Photorhabdus l...
Q6D0S9        208 GMKFWVRFAEKYGSPWVIGKHPRGTPQGEIDNLLDSLEAMIEDAVAAIPDDSSVDIKEAAGkaDSSEIYQNLIAVSRGEI 287 Pectobacterium...
Q6QIC0        208 GLKFWVQFTEKYGSPMLVGKHPRSASDGEKNLLLDCLEDMVQDAVAVVPDDSSIEIKEAAGktGSADVYERLLHFCRGEV 287 Burkholderia v...
WP_012347274  308 SKIILGQTLTSSE--GKSGSQALGNVHNEVRLDILRSDAKRVAATLTSQLIAPLVLFNISGa-dPRRLPRFCIDVPDPED 384 Leptothrix cho...
WP_021761115  308 SIALIGGTLTTDTasGGGGAYALGEVHNQVRWDLQRDDAEQLCATLNRDLVKPLVDLNFGP---QPAYPTLAIDVPEPAD 384 Desulfovibrio ...
jgi:Tgr7_1641 297 SKAILGATLTSQTgeSGGGSYALGEVHNEVRHDILRSDARQIARTLTQALVVPLVRLNTR----LTRMPQWVFDTEQPED 372 Thioalkalivibr...
WP_012728966  298 SKAILGGTLTSQAd-GKSSTNALGNVHNEVRMEVRDSDLHQLAATLTRDLIYPLYALNGKSfqsTRRLPRIEFDTTEPED 376 Tolumonas auensis
Q8EJ08        305 SKVILGGTLTTQAd-GKSSTNALGNVHNEVRQELRDADLALVAETLTRDLIAPLYALNCKSyrsHRRHPRLVFDTTEAED 383 Shewanella one...
Q30VX9        300 NKVIKGQTLTSDVg--nGHSNAATQTHYQLLGDYSDADALMVETAMN-NIAWAYMQVNAA----GEFAPLFGY--VEPDD 370 Desulfovibrio ...
Q2NUR4        288 SIALLGQNQTTEA----NSNRASAQAGLEVTDDIRDADADIVESAVN-QAIRMAVSMNFG----DVASPVWKMWEQGTVD 358 Sodalis glossi...
Q7N1N0        287 SIALLGQNQTTEA----NSNKASAQAGLEVTDDIRDADADVITSAIN-QTIRWVVELNFG----NVECPVYRLWEQQSVD 357 Photorhabdus l...
Q6D0S9        288 AIALLGQNQTTEA----TANKASAQAGLEVTDDIRDGDSDIVTSAIN-QLIRWVVDLNFGS---NVAAPVYKLWEQESVD 359 Pectobacterium...
Q6QIC0        288 SIALLGQNQTTEA----TSTRASAQAGLEVTDDIRDGDKAVVSEAMN-MLIRWICDLNFD----GADRPVFDMWEQEQVD 358 Burkholderia v...
WP_012347274  385 LALYAEALPKLAAA-GMRIGVSDLHRRLRIEEA--DDGEEVLKgppaptmpgappaigapgaidpeaedsaddedpaMPP 461 Leptothrix cho...
WP_021761115  385 LQALAQVIATLGQAgYDEIPLWWIRQKFRIPKA--EGDEPTLRslrq---------------------------astPAG 435 Desulfovibrio ...
jgi:Tgr7_1641 373 LKAYADALPKLAKV--MRIPARWAYDKLRIPQP--EGDEPVLE----------------------------------VAA 414 Thioalkalivibr...
WP_012728966  377 MRDLAYPLRSLVSM-GMKIPAYWVQEKLQIPKA--KDTDEVLKi---------------------------------VDG 420 Tolumonas auensis
Q8EJ08        384 LRALAYPLRAFVSM-GMQIPQNWLHEKTRIPKP--ANGEAVLViqqddpna------------------taasqtalAAL 442 Shewanella one...
Q30VX9        371 YAAQAELDTKLKNL-GVRFKKTYFVRTYDLTEDefELDGEPED----------------------------------APN 415 Desulfovibrio ...
Q2NUR4        359 -DTQATRDEKLSRA-GVVFTPQYFKREYQLQDG--DIDETPPS------------------------------------- 397 Sodalis glossi...
Q7N1N0        358 -ETQANRDVKLSQA-GVRFTPQYWKREYQLQDG--DIDETTLS------------------------------------- 396 Photorhabdus l...
Q6D0S9        360 -KVQAERDERLSSA-GVVFTPQYWKREYQLQDG--DIDETPKE------------------------------------- 398 Pectobacterium...
Q6QIC0        359 -EIQAGRDQKLTQA-GARFTPAYFKRAYNLQDG--DLDERPLP----------------------------------VSA 400 Burkholderia v...
WP_012347274  462 GVKPPVAKRT----------RAKkappAAaavkqvalagTTPPAPAPRDALDDLVDSALSDwqpvmaalvepLMAEIDKA 531 Leptothrix cho...
WP_021761115  436 PAAPEAPPAPqqtraggflpSQLaanaAQsp-------aVTEAEAHAEATVEALSRQVQEE-----------LVAPLLAR 497 Desulfovibrio ...
jgi:Tgr7_1641 415 PALPGRAALR----------DRRaappAR----------AAARTAGDDTLVSEWADRLERDhaaa----fdnLLAPLRGL 470 Thioalkalivibr...
WP_012728966  421 QNNQNEAMLK----------ARVkgiaAL----------SAAQPDNTDLQILQLSKQAstv--------lsgMTKQVQQL 472 Tolumonas auensis
Q8EJ08        443 SAKEGAAKQP-----------------------------DASLNEPSQTALDKALDALTQgqmse---aymgMVEPLLAQ 490 Shewanella one...
Q30VX9        416 HKEPNATAAGdtnf---------------------aehdTAGNPDPYQQALDAFVKTSLPEaakr----nekFMAEVKTV 470 Desulfovibrio ...
Q2NUR4        398 --ERQKNALPlsf------------------------aeAIDADIQAQQDLDDSLDILMNGgtlng--vlapVLEPLFNQ 449 Sodalis glossi...
Q7N1N0        397 --TTPIPPLPlaf------------------------seAVHADLAAQDTLDEALDILMNEgslne--slesLLLPLFYR 448 Photorhabdus l...
Q6D0S9        399 -------TLPgqsl---------------------afaeAVNADVDAQDALDAALDVVMNGgqldd--tlepLLAPLFER 448 Pectobacterium...
Q6QIC0        401 VDTVGAASFA-------------------------------EFEAPDQDALDAALNTLSARdlna---daqaLVAPLLKR 446 Burkholderia v...
WP_012347274  532 LASGESLQAFRDRLPKIAK-QMDDAPLAERVARATFVARLAGEAD 575 Leptothrix cholodnii
WP_021761115  498 LQACGSFEEALATVQTGFD-HAATEGLGHRLARAGFIANLYGQLE 541 Desulfovibrio gigas
jgi:Tgr7_1641 471 LGEVDSLAELRERLADVYD-DMPEEQLAQLLHRALAAAELAGRDE 514 Thioalkalivibrio sulfidiphilus HL-EbGr7
WP_012728966  473 VMNATSLDEIRDGLLEIEP-DISPDELGELLAQAITASELLGMLE 516 Tolumonas auensis
Q8EJ08        491 LQS--EPEQLRAQLEQNYP-NMDTEQLTETLARLMFVAELWGMAN 532 Shewanella oneidensis
Q30VX9        471 LQAAESWEDLQLMLAELLGkSMDEDEQAAFMGDLLTNADLFGRYA 515 Desulfovibrio alaskensis G20
Q2NUR4        450 VKDGVNPSELLGALAELYP-QMNADDLQERLARIMFVATVWGRLH 493 Sodalis glossinidius str. 'morsitans'
Q7N1N0        449 VQNGVNPSDLTGELAELYP-HMDAEGLQEQLARVLFVSNIWGRLH 492 Photorhabdus laumondii subsp. laumondii
Q6D0S9        449 LQSGVRPGELLGELAELYP-QMKADDLQERLARILFVATIWGRLH 492 Pectobacterium atrosepticum
Q6QIC0        447 IANGASADELLGMLAELYP-SLDADALQERLARAIFVANLWGRLH 490 Burkholderia virus BcepMu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap