2UV1


Conserved Protein Domain Family
Gam

?
pfam06064: Gam 
Click on image for an interactive view with Cn3D
Host-nuclease inhibitor protein Gam
The Gam protein inhibits RecBCD nuclease and is found in both bacteria and bacteriophage.
Statistics
?
PSSM-Id: 399215
Aligned: 2 rows
Threshold Bit Score: 174.084
Threshold Setting Gi: 149243729
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2UV1_A  2 MNAYYIQDRLEAQSWARHYQQLAREEKEAELADDMEKGIPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHI 81  Escherichia virus Lambda
Q32GM6  1 MNAWLIPDRIEEQSWARHYQQIAREETEAELADDLEKGLPQHLFESLCIDNLQRHGASKKAISRAFDDDVDFQERMAEHI 80  Shigella dysenteriae S...
2UV1_A 82 RYMVETIAHHQVDIDSEV 99  Escherichia virus Lambda
Q32GM6 81 RYMAETIARHQINIDSEV 98  Shigella dysenteriae Sd197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap