1ZVF,2QNK


Conserved Protein Domain Family
3-HAO

?
pfam06052: 3-HAO 
Click on image for an interactive view with Cn3D
3-hydroxyanthranilic acid dioxygenase
In eukaryotes 3-hydroxyanthranilic acid dioxygenase (EC:1.13.11.6) is part of the kynurenine pathway for the degradation of tryptophan and the biosynthesis of nicotinic acid.The prokaryotic homolog is involved in the 2-nitrobenzoate degradation pathway.
Statistics
?
PSSM-Id: 399210
Aligned: 4 rows
Threshold Bit Score: 274.728
Threshold Setting Gi: 109157069
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZVF_A   2 MFnTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTDYHINPTPEWFYQKKGSMLLKVVDETDAEpkfiD 81  baker's yeast
Q8PAD0   1 ML-VPPINLHAWVEQHRHLLKPPVGNKCIQQDGFIIMIVGGPNARTDYHYDEGPEWFFQLEGEMVLKVQDDGTAR----D 75  Xanthomonas campestri...
2QNK_A   1 --sERRLGVRAWVKENRGSFQPPVCNKLXHQEQLKVXFIGGPNTRKDYHIEEGEEVFYQLEGDXVLRVLEQGKHR----D 74  human
Q19341   1 MSgVTAIEIPQWIQDNQEDFVPPVCNKCMFSDQLKVFYVGGPNQRKDFHLEEGEEFFFQRKGDMVLKVIEKGQVR----D 76  Caenorhabditis elegans
1ZVF_A  82 IIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGENDKIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFE 156 baker's yeast
Q8PAD0  76 IPIRAGEIFLLPPKVPHSPQRAAGSIGLVIERERLPHEQDGLQWYCPQCNHKLYEAMFPLENIETDFPPVFDHFY 150 Xanthomonas campestris pv....
2QNK_A  75 VVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTXDVLFEKWFYCKDLGTQLAPIIQEFF 149 human
Q19341  77 LVIKQGEMFMLPARVEHSPQRFSNSIGLVVERERKNTEFDCVRFLVGSSNITLFERWFYLTDVVKDLPPLIKEFY 151 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap