Conserved Protein Domain Family
SynMuv_product

?
pfam06047: SynMuv_product 
Ras-induced vulval development antagonist
This family is from synthetic multi-vulval genes which encode chromatin-associated proteins involved in transcriptional repression. This protein has a role in antagonising Ras-induced vulval development.
Statistics
?
PSSM-Id: 399205
Aligned: 37 rows
Threshold Bit Score: 133.906
Threshold Setting Gi: 1334361721
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007396901          328 ERQYGGALLRGEGSAMAAFLKDGTdvRIPRRGEIGLTSGEIATFENVGYVMSGSRHRRMNAVRMRKENQVISAEEKRGIL 407 Phaner...
XP_001731050           14 QRAYGKQLLPGEGAAMASYVQEGK--RIPRRGEIGLSAEQIAAFERAGFVMSGSRHQRMNAVRVRKENQVISAEERQSEL 91  Malass...
EPB89730              260 ERAYGSQLLPGEGSAMAAYVKEGK--RIPRRGEIGLSGDQIAEFEKAGYVMSGSRHQRMNAVRLRKENQVISAEEKRLVL 337 Mucor ...
EOQ99563              116 DKDFGREMLRGEGTAMAQFVQDGQ--RIPRRGEIGIESGEIDKLEQAGYVMSGNRHKRMNEVRVRKENEVYTAEEKRKMV 193 Wallem...
EKC97552              367 eREAGKNLLPGEAAAMRQYVESGQ--RIPRRGEIGLDQNKIMQYEASGFVMSGSRNARMNAVRVRKETQVVNAEDKIDLM 444 Tricho...
Q5KH16                330 gRSAFANMLPGEGEAIMAYAESGQ--RIPRRGEIGLDSEQIAVYESSGYVMSGSRHQRMNAVRMRKENQVINEAEKRAIL 407 Crypto...
XP_016294096           29 PRAYGGALLPGEGSAMASYVQDGK--RIPRRGEIGLSSDQIEAYEKAGYVMSGSRHHRMNAVRMRKENQVISAEEKRTML 106 Kalman...
WGS:AAWC:PGTG_00913.3 291 PKEFGRALRPGEGSAMAAFIEAGE--RIPRRGEIGLTGTEIEKFENVGYVMSGSRHRRMNAVRIRKENQVISAEEKRGIL 368 Puccin...
KDE02558              331 rNAYGGALRPGEGTAMAQFVQDGA--RIPRRGEIGLESEQIEKFEQAGYVMSGSRHRRMNAVRVRKENQVISAEEKRGIL 408 Microb...
CCA72846               39 EREYGGALLRGEGSAMAAFVQENA--RIPRRGEIGLSSNEIAAYENVGYVMSGSRHRRMNAVRMRKENQVISAEEKRSIL 116 Serend...
XP_007396901          408 QLQKEERERREAILREEFQELVKD 431 Phanerochaete carnosa HHB-10118-sp
XP_001731050           92 HQKRQDRARKEADIIAQFREMVDm 115 Malassezia globosa CBS 7966
EPB89730              338 QHAQEQKIKRENEIISGFREILSD 361 Mucor circinelloides f. circinelloides 1006PhL
EOQ99563              194 KEAAEDKMKRENEVVASFKELVSE 217 Wallemia ichthyophaga EXF-994
EKC97552              445 KTKKEEADRKEGEIISQFREMVEE 468 Trichosporon asahii var. asahii CBS 8904
Q5KH16                408 KLQREERMKKEGAIVSQFKEMIDE 431 Cryptococcus neoformans
XP_016294096          107 RLQAEEKAKKEREIVSQFKELVDt 130 Kalmanozyma brasiliensis GHG001
WGS:AAWC:PGTG_00913.3 369 KMQAEEKAKREGQIISSFRELVDT 392 Puccinia graminis f. sp. tritici CRL 75-36-700-3
KDE02558              409 QLQAQEKAKRENQIVSSFRELVDT 432 Microbotryum lychnidis-dioicae p1A1 Lamole
CCA72846              117 KLQKEEKQRREELLKAEFKELVEE 140 Serendipita indica DSM 11827
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap