2LA3


Conserved Protein Domain Family
NTP_transf_6

?
pfam06042: NTP_transf_6 
Nucleotidyltransferase
This family consists of several hypothetical bacterial proteins of unknown function. This family was recently identified as belonging to the nucleotidyltransferase superfamily.
Statistics
?
PSSM-Id: 399202
Aligned: 103 rows
Threshold Bit Score: 161.522
Threshold Setting Gi: 504049740
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LA3_A                 26 TIIRDLGLKDSWLAAGSVRNFIWNLLSDKSPFDHETDIDVIFFDP-DF-SYEETLLLEKKLREDFP--QYQWELKNQVYM 101
WP_014283734           49 kGIRSLRLPDWCISGPSIAWPLWTALKGKPAMAGNHQLYITYYDPsDQ-ALEKEATYLRHIRQVLsagPYQVHLSNQAGH 127 Pseudo...
Q0ATF8                 35 ERAHGLDLPDWALMAGAVYKAVWNVQTGRPGGHGINDYDLGYFDAsDL-GAAAEAAVVGPAEARFAdlPVPVEVCNQARV 113 Marica...
WP_014130601           34 EILRAAGLPQALVGGGAVYQTVWNGLTGRPTWYGVKDIDAIYFDDtDL-SYAAEDAVIQRVGALLSdaPVPVEIRNQARV 112 Pelagi...
Q47ZE1                 33 ilekiNHLPNAWVGAGIIFQNVWNVIHGYDFNTFIKDIDVLYWDEnDL-SWQSENSYIQALTESLSemNIPFDVKNIARV 111 Colwel...
CCG43661               22 fdATDHYIDDYYTGAGVITQTVWNKLYDFDFTYGINDAGIIYFNSlEQpSRELERIKETKIRKALPhfPFEIDLTNEALV 101 Haloba...
WP_012652352           24 RNWEKIALPDCWLVAGAVAQTVWNHSLGLPLTHGINDVDIVYFDAgDL-SESAEAEHAFRIRSSFSdlPVWIDVKNEARV 102 Agroba...
WP_012654860           22 dgwDKLALPDCWLVAGAIAQTVWNKTFDLPSTHGISDVDIVYFDPdDL-TEKGEVDRAARIRAAFShlPVWIDVKNEARV 100 Agroba...
Prjna32935:ECBG_00121  29 kDVSALGIPNLYVGGGSVTQSVWNHLFSKPIGYGISDVDIVYFDT-DL-SQEKERMVLEQIVETTKqnQYALDVKNEARV 106 Entero...
jgi:Cphy_2904          31 KRAKQLNIDNYYIGAGCITQTVWNYLSNYPLDYGIKDIDFVYFDNlNL-DFESENRVIMQVKQLYSalRIETDVKNQARV 109 Lachno...
2LA3_A                102 HQHSPhT------ASYTSSRDAMSKYPERCTAVGLRLNEELDFELYVPYGLEDILNFQVRPTPHFLENEDrmelYQTRLs 175
WP_014283734          128 VVHHD-KdsmsngTPVTCTAEALVRDPVQTYALGVRLETSGTFTVLAPFGLSGVFAMKMERNTGYCDEEH----FLYKL- 201 Pseudo...
Q0ATF8                114 HIWFN-EaygtrrDPLVDTNDALRHFASLTHAVAIRLDGDGQPELLAPFGLAAVFSRTIRPTPDL-AGPEa---WNRKI- 187 Marica...
WP_014130601          113 HLWFG-EkfgfdvPPLKSSAEALTRYASRTHAVAVGLDDLGRLNVEAPFGLDDLFAFRVTPNRLGKSRQA----HIEKG- 186 Pelagi...
Q47ZE1                112 HLWYE-ErfgipkARYHSVQESISTWPVIGACMAMRM-NKGQLEFIAPFGFQDMFSLRVRPNKILVNQTI----YEGKA- 184 Colwel...
CCG43661              102 HHWYE-QkfnkkiAAYRSAEEAIETWPTTASAIGVK-RVDGEYKIYAPFGLQDLFKGIVRPNKALVPEHV----YKSKA- 174 Haloba...
WP_012652352          103 HLWYE-AkfkypiDPYTSAADAITTFPTTATAVGLQSRTDG-LELCAPYGISDLLDLVVRPVKKQITREI----YDNKV- 175 Agroba...
WP_012654860          101 HTWYE-TkfgyqiAPYTSTAEAITTFPTTATAIGLK-PTGGSLLLDAPFGTDDLMNGVVRPNKKQITREI----YDAKT- 173 Agroba...
Prjna32935:ECBG_00121 107 HLWYE-EefgfsiPAYTSTEEAISTWPSTATSIGVFFDQESKLQVFAPYGMYDLFSGIVRPNKAMISREV----YEKKI- 180 Entero...
jgi:Cphy_2904         110 HLWYK-DhfgysiEPYTSLESAINTWPTTASAIGIRLDNNNEFKVYAPFGLNDLFGKIVRANKSQITKQI----YEKKT- 183 Lachno...
2LA3_A                176 kKNWQEKWKNL 186
WP_014283734          202 -RRVEAMWPGI 211 Pseudovibrio sp. FO-BEG1
Q0ATF8                188 -AEQSRLWPEL 197 Maricaulis maris MCS10
WP_014130601          187 -ERAKSVWPEV 196 Pelagibacterium
Q47ZE1                185 -IKWKEQWPKL 194 Colwellia psychrerythraea 34H
CCG43661              175 -VKWKTRWPGL 184 Halobacillus halophilus DSM 2266
WP_012652352          176 -TRWVGLWPGL 185 Agrobacterium
WP_012654860          174 -MRWITVWPNL 183 Agrobacterium
Prjna32935:ECBG_00121 181 -EKWCSKWPEL 190 Enterococcus casseliflavus EC20
jgi:Cphy_2904         184 -ASWLGKWSDL 193 Lachnoclostridium phytofermentans ISDg
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap