Conserved Protein Domain Family
Mqo

?
pfam06039: Mqo 
Malate:quinone oxidoreductase (Mqo)
This family consists of several bacterial Malate:quinone oxidoreductase (Mqo) proteins (EC:1.1.99.16). Mqo takes part in the citric acid cycle. It oxidizes L-malate to oxaloacetate and donates electrons to ubiquinone-1 and other artificial acceptors or, via the electron transfer chain, to oxygen. NAD is not an acceptor and the natural direct acceptor for the enzyme is most likely a quinone. The enzyme is therefore called malate:quinone oxidoreductase, abbreviated to Mqo. Mqo is a peripheral membrane protein and can be released from the membrane by addition of chelators.
Statistics
?
PSSM-Id: 399200
Aligned: 143 rows
Threshold Bit Score: 711.13
Threshold Setting Gi: 399160359
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
C4LEV7          5 HADVTLVGGGIMSATLAMLIHRLDPALHICMIEQLPDIALESSGALNNAGTGHAGYCELNYTPHDKDGNVLIQRALEINA 84  Tolumonas auen...
Q5HL19          6 KKDVVLIGAGVLSTTFGSMLKTIAPDWDIHLYERLDRPGIESSNERNNAGTGHAALCELNYTVQQPDGSIDIEKAKEINE 85  Staphylococcus...
Q5HKD6          6 HKNIVVVGAGIIGTSVATMLSKVSPNWHIDMFERLEGAGIESSNENNNAGTGHAALCELNYTVEQDDGSIDASKAQEINE 85  Staphylococcus...
jgi:Aaci_2142  28 RSDVALIGGGIMSATLGTLFRQLAPDWTITVFERLDEVAVESSNEWNNAGTGHSALCELNYTVEQPDGSIDISKAIQVNE 107 Alicyclobacill...
C4L056          7 RTDVILIGAGIMSATLGSLFKELVPEWNIKVFEKLDAAGEESSNEWNNAGTGHAALCELNYTTENADGTIDISKAVNVNE 86  Exiguobacteriu...
B1YG64          7 QTDVILIGAGVMSATLGVLLKELAPDMKIKVFEKLASAGEESSNEWNNAGTGHAALCELNYTTENADGTIDISKAVKVNE 86  Exiguobacteriu...
Q8CV11          7 QADVILIGAGIMSATLGSLLKELSPNLEIRVFEKLENPGEESSNEWNNAGTGHSALCELNYTSERTDGSIDINKAVKVNE 86  Oceanobacillus...
WP_014096646    7 KTDVILIGAGIMSATLGTLLKELTPDWEITVYEKLAKPAEESSNEWNNAGTGHSALCELNYTPEKPDGSIDITKAVNVNE 86  Bacillus coagu...
EGF76138        7 KTNVILIGAGVMSATLGTLLKELVPEWEIKVFEKLSKPGEESSNGWNNAGTGHSALCELNYTPERHDGSIDTSTALKINE 86  Batrachochytri...
Q9Z9Q7          7 KTDVILIGAGIMSATLGSLLKELKPEWEIKVFEKLANAGEESSNEWNNAGTGHAALCELNYTAEKSDGTIDISKAVKINE 86  Bacillus halod...
C4LEV7         85 AFEVSLQFWSHLVNADRENiTPSSFINRVPHLSAVWGQKDIDFLKARYTLLKSHHLFSEMKWSEDEQTLADWMPLMMKGR 164 Tolumonas auen...
Q5HL19         86 QFEISKQFWGHLVKSGEIQ-NPKEFINPLPHISFVRGKNNVKFLKDRYEAMKQFPMFDNIEYTEDIEEMRKWIPLMMKGR 164 Staphylococcus...
Q5HKD6         86 QFELSRQFWGNLVKNGDIS-NPEEFIQPLPHISFVMGPTNVNFLRKRYETLRTLPMFDTIEYTEDMETMRKWMPLMMENR 164 Staphylococcus...
jgi:Aaci_2142 108 QFLVSRQFWSFLVRQGIIE-HPRDFIVPVPHMSFVQGETNVAFLKKRHQLLSQHPLFQGMEYSEDPERLREWIPLMMKDR 186 Alicyclobacill...
C4L056         87 QFQISRQFWAHLVKQGLIE-NPGAFIRSIPHMSMVQGEKNVDFLKRRLEALTTNPLFEGMVLSDDPSQLQEWIPLIMDGR 165 Exiguobacteriu...
B1YG64         87 QFQLSRQFWSHLVKEQVLP-NPKEFIMPIPHMSMVEGAENVTFLKKRLEALSANPLFKGMEFSEDPEQLKEWIPLIMEGR 165 Exiguobacteriu...
Q8CV11         87 QFQLSRQFWSYLVNRNLIR-NPEDFIRALPHISLVQGEDNVTFLRKRFKALVNHPLFNGMEFSDDNEKLKEWMPLIMDKR 165 Oceanobacillus...
WP_014096646   87 QFQLSRQFWSYLVSKGLIH-NPQDFIRPIPHMSLVEGEANVAFLKKRFKALSAHPLFEGMTFSDDPEQLKEWIPLVMEGR 165 Bacillus coagu...
EGF76138       87 QFQVSKQFWSYLVNNKSIQ-NPQDFIMPLPHMSLVHGEKDVTFLKKRFEALSNNALFAGMEFSDNPEKLIEWMPLIMKER 165 Batrachochytri...
Q9Z9Q7         87 QFQISRQFWAYLVSQNLIS-NPQDFIMPIPHMSLVQGEDNVAYLKKRFKALSNIPLFEGMEFSNDPEKLKEWIPLVMEGR 165 Bacillus halod...
C4LEV7        165 QAEPKLAATRVEHGADVNFGALTRILVSYLQKNANFELLTNTRVVDLHRAHGAKkpWAVKVKNQNSAAKQTIESPFVFLG 244 Tolumonas auen...
Q5HL19        165 EDKGYMAASKIDEGTDVNYGELTRKMAQNLKNSPNVEVQYKHEVVDFERLSNGK--WSVKIKNLNNGQVFEHQTDYVFIG 242 Staphylococcus...
Q5HKD6        165 EPGHQMAASKIDEGTDVNYGALTRKLAHYLEQKSNVSLKYNHDVVDLTQREDGK--WEVVVENRETKEKVTKIADKVFIG 242 Staphylococcus...
jgi:Aaci_2142 187 KLDRPIAATWIASGTDVNFGALTRMLFQYLER-EGVDVQCGKEVQDLKRTRDGM--WQLRVRDVKTGATYEHVSKFVFVG 263 Alicyclobacill...
C4L056        166 TSDEPIAATKIDSGTDVNFGALTRMLFDHLTS-NGVELNYGHSVEDVKRLENGH--WEVKVKDMSQNTIETHTAPFLFIG 242 Exiguobacteriu...
B1YG64        166 TSPEPIAATKIDSGTDVNFGALTRILFDHLKQ-LDVEINYGHGVEDLKRVDGG---WEIKVKNERDNRIEHHTAKFVFIG 241 Exiguobacteriu...
Q8CV11        166 DTNEPIAATKIDSGTDVNFGALTRLLFQEFDH-KGIDVNYNHSVEDIKRNSEGL--WEVKVHDMNDEKIEYHTAKFVFIG 242 Oceanobacillus...
WP_014096646  166 TSNEPIAATKSDAGTDVNFGALTRILFDHLER-QDVEINYKHAVQDIQRTPEGN--WEVKVHDIEHNRIEYHTAKFIFIG 242 Bacillus coagu...
EGF76138      166 IANGPIAATKIDSGTDVNFGALTSMLFDHLKD-NDVEINYRHSVEDMKRTEDGS--WEVKVHDIDGERLEYHTADFVFIG 242 Batrachochytri...
Q9Z9Q7        166 TSNEPIAATKIDSGTDVNFGALTRMLFEHLKE-QNVEVHYKHSVKDIKRTSDGS--WSVKVQEIESGTIEYHTANFVFIG 242 Bacillus halod...
C4LEV7        245 AGGVALHLLQNSGIEEAAGYGGFPVSGQWLICQNQDLIRQHHAKVYSLAAVGAPPMSVPHLDTRIINGKPSLLFGPYAGF 324 Tolumonas auen...
Q5HL19        243 AGGGAIPLLQKTGIPESKHLGGFPISGQFIACTNPQVIEQHDAKVYGKEPPGTPPMTVPHLDTRYIDGERTLLFGPFANV 322 Staphylococcus...
Q5HKD6        243 AGGHSIPLLQKSGVKQREHLGGFPISGQFLRCTNPDIIKQHAAKVYSKEPQGKPPMTVPHLDTRYINGKQTLLFGPYANI 322 Staphylococcus...
jgi:Aaci_2142 264 AGGWSLLLLQKSGIDEGKGIGGFPVSGLFMVCENPEIVRQHRAKVYGKAPVGAPPMSVPHLDSRVIGGREYVLFGPFAGF 343 Alicyclobacill...
C4L056        243 GGGGSLPLLQKTGIPESKQIGGFPVSGLFLVCKNREVIEQHHAKVYGKAKVGAPPMSVPHLDTRFIDGRKELLFGPFAGF 322 Exiguobacteriu...
B1YG64        242 GGGGSLPLLQKTGIPESKQIGGFPVSGLFLVCKNPEIAERHHAKVYGKAKVGAPPMSVPHLDTRYIDGQKSLLFGPFAGF 321 Exiguobacteriu...
Q8CV11        243 AGGGSLPLLQKTGIKESKHIGGFPVSGLFMVCNNPEVIEQHHAKVYGKAKVGAPPMSVPHLDTRFIDGKKSLLFGPFAGF 322 Oceanobacillus...
WP_014096646  243 AGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCNNPEVINRHHAKVYGKAKVGAPPMSVPHLDTRYIDHKKCLLFGPFAGF 322 Bacillus coagu...
EGF76138      243 AGGGSLPLLQKTDIPESKHIGGFPVSGLFMVCDKPEVVEQHHAKVYGKAKVGAPPMSVPHLDTRYIDGKKSVLFGPFAGF 322 Batrachochytri...
Q9Z9Q7        243 GGGGSLPLLQKTGIPESKNIGGFPVSGLFMVCNNPEVVEQHHAKVYGKAKVGAPPMSVPHLDTRYIDNKKSLLFGPFAGF 322 Bacillus halod...
C4LEV7        325 TTKFLKHGSPFDLAKSVRPHNLKSLIGAGKNNFDLTKYLVKEVFQTHSQRMQSLEAFIPNARAEDWQLAHAGKRVQIIKR 404 Tolumonas auen...
Q5HL19        323 GPKFLKHGSNLDLFKSIKPYNITTLLASAVKNLPLIKYSFDQVIMTKEGCMNHLRTFYPEARDEDWQVYTAGKRVQVIKD 402 Staphylococcus...
Q5HKD6        323 GPKFLKFGSNLDLFESIKPYNITTMLASAVKNVPLIKYSIDQMIKTKEGCMNYLRTFIPDAKDEDWELYTAGKRVQVIKD 402 Staphylococcus...
jgi:Aaci_2142 344 SPRFLKTGSMLDLLKSVKLHNLSTLLAAGAKNASLTLYLIRQLMLTKKQRMDELREFVPTARDEDWRLVVAGQRVQVIKR 423 Alicyclobacill...
C4L056        323 TPKFLKTGSNLDLIRSVKPNNVITMLAAGAKEMPLTKYLIEQVLLSHDKRMDELREFIPNAKNEDWEIVVAGQRVQVIKD 402 Exiguobacteriu...
B1YG64        322 SPKFLKTGSNLDLITSVKPNNVLTMLAAGAKEMGLTKYLIEQVLLSTEQRMNELREFIPNAKTEDWDVVVAGQRVQVIKD 401 Exiguobacteriu...
Q8CV11        323 SPKFLKTGSLFDLMHSVKSDNLFTMLSAGMKELPLTKYLIQQVVLSNEKRMEELREFIPNAQSKDWDIVIAGQRVQVIKD 402 Oceanobacillus...
WP_014096646  323 SPKFLKTGSNLDLIGSVKPNNVVTMLASGAKNVPLVKYLIGQLLLSDEKRLETLQEFIPDARLEDWDVVVAGQRVQVIKD 402 Bacillus coagu...
EGF76138      323 TPKFLKTGSYFDLLGSVKPDNVFTMLSAGAKEMKLTKYLIQQVMLSNEKRLEELREFIPTAKSGDWHVIEAGQRVQVIKD 402 Batrachochytri...
Q9Z9Q7        323 SPKFLKTGSNFDLIGSVKPYNVFTMLAAGAKEMSLTKYLIQQVMLSKEKRMAELREFMPNAKSEDWDIVVAGQRVQVIKD 402 Bacillus halod...
C4LEV7        405 CHHKW-GKLEFGTEIVAAEDGSLAALLGASPGASVSVKTMLDVLERCFPQQMQsAEWQDKLKTMIPSYGRSLINDANLSA 483 Tolumonas auen...
Q5HL19        403 TEENGkGFIQFGTEVVNSEDHSVIALLGESPGASTSVSVALEVLEKNFPEYAK--NWEPKIKKMIPSYGESLIDDVQLMR 480 Staphylococcus...
Q5HKD6        403 SEQHGkGFVVFGTEVVNSDDNSMIALLGESPGASTSLSVVLEVLEKNFADDKE--AWEPVVKEMVPTYGRSLINDEKLMR 480 Staphylococcus...
jgi:Aaci_2142 424 RPR---GELQFGTEVVSARDGSIAALLGASPGASVVVSIMLEVIRKCFPDRL--PEWENKIREMIPSYGVTLRHRPDLMR 498 Alicyclobacill...
C4L056        403 TPQ-GkGTLQFGTEVVSSEDGSVAALLGASPGASTAVHVMLKVLEQCFPQHL--PEWEPKIKEMVPSYGLKLSEHPDLFK 479 Exiguobacteriu...
B1YG64        402 TPQ-GkGALQFGTEVVSAADGSVAALLGASPGASTAVPVMLEVLAKCFPDQL--PSWEAKIKEMIPSYGTSLVANPELFD 478 Exiguobacteriu...
Q8CV11        403 TEDGGkGTLQFGTEVVCGEDGTMAALLGASPGASTAVHVMLEVIQKCFPEHL--QEWEPKIKEMIPSYGIALSENPELYK 480 Oceanobacillus...
WP_014096646  403 TEAGGkGTLQFGTEVVTAADGSVAALLGASPGASTAVHVMLEVIEKCFPDRK--NAWAPKIKEMIPSYGVRLAENPELLH 480 Bacillus coagu...
EGF76138      403 TEAGGkGTLQFGTEVVTAGDGSIAALLGASPGASTAVSIMLEVMEKCFPQYI--NAWEPKIKEIIPSYGVPLLDNPDLIR 480 Batrachochytri...
Q9Z9Q7        403 TEAGGkGTLQFGTEVVSSADGSIAALLGASPGASTAVHVMLEVLEKCFPHHM--LEWQPKIKEMIPSYGVSLAENRELFQ 480 Bacillus halod...
C4LEV7        484 SVRRYTLDTLKL 495 Tolumonas auensis DSM 9187
Q5HL19        481 KIRKQTSKDLEL 492 Staphylococcus epidermidis RP62A
Q5HKD6        481 ETRRETSKNLHL 492 Staphylococcus epidermidis RP62A
jgi:Aaci_2142 499 SIQAETAEVLGL 510 Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
C4L056        480 TIHESTAITLGL 491 Exiguobacterium sp. AT1b
B1YG64        479 QIHAETTKTLEL 490 Exiguobacterium sibiricum 255-15
Q8CV11        481 EIEVSIEKALGL 492 Oceanobacillus iheyensis HTE831
WP_014096646  481 QIHAETAETLGL 492 Bacillus coagulans
EGF76138      481 EIHTQAAHALGL 492 Batrachochytrium dendrobatidis JAM81
Q9Z9Q7        481 EIHQSTAEALGL 492 Bacillus halodurans C-125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap