2NN4


Conserved Protein Domain Family
DUF910

?
pfam06014: DUF910 
Click on image for an interactive view with Cn3D
Bacterial protein of unknown function (DUF910)
This family consists of several short bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399187
Aligned: 45 rows
Threshold Bit Score: 68.6831
Threshold Setting Gi: 506344772
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NN4_A                  2 LNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQ 62  Bacillus subtilis
WP_013059184            1 MNTLYDVQQLLKSFGIFIYVGDRIADLELMEAEVKELYQSNLIDVRDYQMAILLLRRELKQ 61  Bacillus
WP_015594966            1 MKTIYDIQQFLKGFGTFIYVGDRLANLELMEEEIKELFYSKLIEKNELSNAMQILRHEIQF 61  Bacillus sp. 1NLA3E
WP_014643754            1 MKTIYDIQQHLKKFGTYIYVGDRLADLELMEDEVKELYRSQCMEKEDFQMALLLLRGEIAr 61  Halobacillus halophilus
WP_015864491            1 MKTVYDVQQLLKQFGTIIYVGDRLADLELMEEELKELYQSQLIDVKDYQMALFILRHEAQL 61  Bacillaceae
PRJNA212797:N288_18125  1 MKSIYDVQQFLKKYGTFIYIGDRSADLELMEEELMELRQSQLIDPKDFQTALLLVRHERQL 61  Bacillus infantis NRRL B-...
Q5WH90                  1 MKTLFEVKQLLKQYGAFIYTRDLDADMQLMQMEMEELHRLGLIERGEFQQAMLVLKREQRA 61  Bacillus clausii KSM-K16
Q8EQ09                  1 MKTMIEVRNLLKRFGAFIYTGDRLGDLELIEFELNDLYQYGFITQHEFLMAKLCVEKEKNQ 61  Oceanobacillus iheyensis
BAK16046                1 MKSMLDVLGILKQYGIYIYTKDRIGDLYLMEDEIKELYKSKFIETKDFQMALLILRQEEQr 61  Solibacillus silvestris S...
ADC50852                1 MNTLFDVMQLLKKYGIFIYTGERAVDLELMEEEVRELYEMKMIEAETFQKALLLIRREKt- 60  Bacillus pseudofirmus OF4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap