Conserved Protein Domain Family
TRP

?
pfam06011: TRP 
Transient receptor potential (TRP) ion channel
This family of proteins are transient receptor potential (TRP) ion channels. They are essential for cellular viability and are involved in cell growth and cell wall synthesis. The genes for these proteins are homologous to polycystic kidney disease related ion channel genes.
Statistics
?
PSSM-Id: 399184
Aligned: 197 rows
Threshold Bit Score: 149.21
Threshold Setting Gi: 301116922
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EME48537      199 VGSVLGIFTFVALIAsfaTAIY-GEAvPT------------MRLHYAHSlsVGVVFAVWQHIFFTGALSVNWPSVLVAWW 265  Dothistroma s...
EMT61990      174 VTYLSVGVVGAALLVsgaSAASsALS-GTagagh----------ggapSpsFAETLGWFQGMAMNGMLSVDYPPVYRSFA 242  Fusarium oxys...
EJP64554      173 VSYVAAGVAGVALLAsgiSAAGaALG-SGa----------gGPGTGTVSpsFTETFGWFQGMAMNGMLSVSYPPVYQSFT 241  Beauveria bas...
XP_006674730  170 VSYVAVGIAGVALLGsgvSAVGaALG-GGt----------sG-GAGTVSpsFSEVVGWFQGMAMNGMLSVQYPPIYESFT 237  Cordyceps mil...
EFY90929      173 ISYVAAGVAGAALIMsgvSAVGaALS-GGsaal----gsgsGGAMGSISpsFGETIGWFQGMAMNSMLSVDYPPIYRNFA 247  Metarhizium a...
CCE30584      177 VSYIAAGIAGAALVMtgiSALGaALS-GGtasl-----ggsGMATAAVSpsFSETMGWFQGMAMNSMLSVQYPQIYRSFA 250  Claviceps pur...
Q7SF57        171 VSYIAAGVAGAALILtgiSAAGaAVA-GSsaaagsaggaasSAGVGTISpsFTEVFGHFQGMAMNGMLSVSYPPVYRNFA 249  Neurospora cr...
XP_003347560  171 VSYVAAGVAGAALILtgiSAAGaAVA-GGsaaaggaggaasSAGMGTISpsFTEVFGFFQGMAMNGMLSVNYPPVYRNFA 249  Sordaria macr...
KLU87740      177 VSYVAAGVAGAALVMtgvTAIGaAVA-GGsgaa----aggsAAGVGTISpsFTEVFGWFQGMAMNGMLSVSYPQVYRSFA 251  Magnaporthiop...
XP_007789141  169 ISYIVAGIAGAAFVAtgaSALGaAVS-GAssta--------gggaGTISpsFSEMVGVFQGFAVNGMMSVNHPPVYRSFA 239  Eutypa lata U...
EME48537      266 TNFAWAGGMIYTSSMQRSIDSLIGTNIGnts------qvgAAQS---GADNSNVGGGydisliykRMMgsgierafsaas 336  Dothistroma s...
EMT61990      243 KNFGFSAGIIPWESLQKSIDNFRNMTGGdltnds-fevlrNATLvfsDNSTS---SPedhsykvkRAFntfes------- 311  Fusarium oxys...
EJP64554      242 KNFGFSVGLVPWTGALSAIDSLRESTGGnltydn-aeyvaNAT------------AGqgsmfhakRALgai--------- 299  Beauveria bas...
XP_006674730  238 KNFAFSVGLVPWSGMLTSIDKFRESTGGnltndn-aayiaNAT------------AGqggalhlkRAVgaa--------- 295  Cordyceps mil...
EFY90929      248 KNFAFSVGIFPWSGMQSTIDNFRSKTGGnltqds-fsylqNATLvfpDGSTSS---PnkglfnfkRAIddf--------- 314  Metarhizium a...
CCE30584      251 KNFAFSAAVIPWSGMQSAIDGFRSHTGGdldqds-yayleKATLvfpDGTTRS---PnqglfkfkRAVdaf--------- 317  Claviceps pur...
Q7SF57        250 KNFGFSTGIIPWAAMQTSIDDFRQKTGGnlthnsftflreNATLvfpDNTTTTLHENkassapvkRAFtef--------- 320  Neurospora cr...
XP_003347560  250 KNFGFSTGIIPWAAMQTSIDDFRGKTGGnlthnsfmflreNTTLvfpDNTTMTLHENnsgslpvkRAInef--------- 320  Sordaria macr...
KLU87740      252 KNFAFSTGLVQWTTLQESIDQFRNMTGGnltads-vatlrNATLvypDGSIST--SDksqplklkRALdsi--------- 319  Magnaporthiop...
XP_007789141  240 KNFGFSTGLFPWRSMQVSIDGFREATGGnltqds-vqfleKTTLvfsDGSTA---APagssanskRALagf--------- 306  Eutypa lata U...
EME48537      337 rhplirniaseiygrdysivlsrdvlqktvertlHARDntiad------asdgyKWyGqPVHnGLPL------P-GnysG 403  Dothistroma s...
EMT61990      312 ------------------------------lanlAIRGvetsvg----------------dtseseGgqslknQtLsvsG 345  Fusarium oxys...
EJP64554      300 -------------------------------atiALRDietsvn----------------steatkSpss---fqQtaqG 329  Beauveria bas...
XP_006674730  296 -------------------------------aaiVLRDietsvn----------------atddahGgtn---fqKtvqG 325  Cordyceps mil...
EFY90929      315 -------------------------------vdlANRAvdtsvn--------------stdpvgSSDsnd---lqHkvkG 346  Metarhizium a...
CCE30584      318 -------------------------------vdlASREietsvn-------------stepvsSGSDtne---lqHkvkG 350  Claviceps pur...
Q7SF57        321 -------------------------------irlAAREietsvnltdssaanttDS-GnGTTtASDNtds---frVavkG 365  Neurospora cr...
XP_003347560  321 -------------------------------irlATREietsvnl--tepgaatES-GnG-TtALDNpes---frVavkG 362  Sordaria macr...
KLU87740      320 -------------------------------vllATRDiqtsvnt---tapaaaGEq--G------Vpaq---frMavtG 354  Magnaporthiop...
XP_007789141  307 -------------------------------adlVRRQletgvne---tatedaAA-AtG------Tqss---fqAsvsG 342  Eutypa lata U...
EME48537      404 FAGTLAEEGIAVSNAFMTGFLWFLILLVLMVASVAGFKWMLECLTRLKwIREDKLKYFRNHWLGLAGIVALRTWFIGWFI 483  Dothistroma s...
EMT61990      346 ISAYIQQYSVPKSNTFMMVLLVVAIIIATIIVSILLVKAILEFWALFG-SFPQSLAGFREHYWGSIARTITHLILVLYGI 424  Fusarium oxys...
EJP64554      330 IEKYARQLAVPKSDIFMMALLVVAIIIASIVLVMVLVKVILEAWAIWG-TFPESLKGFRKHYWGSIARTITNLILLLYGI 408  Beauveria bas...
XP_006674730  326 IEGYARRLSVPKSDIFITALLVVAIIIAAIVVVILLVKVILEAWAIWG-TFPQSLKGFREHYWGSIARTITNLILLLYGI 404  Cordyceps mil...
EFY90929      347 IQAFAEKLLVPKSNIFMTALLIVAIIIAAIVVGILLVKVILEAWALFG-SFPEGLRGFRKHYWGSIARTITSLILLLYGI 425  Metarhizium a...
CCE30584      351 IQAFAEQLLVPKSNIFMTALLLVAILIATIVLGILLVKVILETWALFG-SFPQSLKGFRKHYWGSIARTITSLILLLYGI 429  Claviceps pur...
Q7SF57        366 IQSYVQQLSIPSANMFMTILLIVAIIIAAIVVGILLVKVVLEIWALFG-SFPAKLSGFRRNYWISITRTITSLIMLLYGV 444  Neurospora cr...
XP_003347560  363 ISQYVEQLSIPSANMFMTILLIVAIIIAAIVVGLLLVKVVLEFWALFG-SFPQKLAGFRKHYWISIARAITSLIMLLYGV 441  Sordaria macr...
KLU87740      355 IQAYASELAVPSANTFMTVLLIVAIVIAAIAVGILLFKLILEFWALFG-NFPKSLIGFRKHYWGSIARAITSLILLLYGV 433  Magnaporthiop...
XP_007789141  343 FEAYAEELAVPSANSFMTVLLITAIIIGVIIVGLLLVKVILEAWSLWG-SFPQGLTGFRKHYWGSIARTITSLILLLYGI 421  Eutypa lata U...
EME48537      484 LMFLTIFQFTYDS-SGGVKGIAAIVFIICFlgmpaiaayavwykwciadneadrangfernkllgGkfpV-PWFgkkqpq 561  Dothistroma s...
EMT61990      425 WVLYCVFQFTVGD-SWAAQLLAGVTLAIFT-----------------------------------A---IlGWF------ 459  Fusarium oxys...
EJP64554      409 WVLYCVFQFSRADsSWVAKLLAGITLAIFS-----------------------------------G---VlGFF------ 444  Beauveria bas...
XP_006674730  405 WVLYCIFQFSRADsSWAAKTLAGVTLALFT-----------------------------------G---VlAFF------ 440  Cordyceps mil...
EFY90929      426 WVLYCVFQFTHGD-NTIAKVLAAVTLAIFT-----------------------------------G---IlAFF------ 460  Metarhizium a...
CCE30584      430 WVLYCVFQFTRGD-SVVAKTLAGVTLAIFT-----------------------------------G---IlGFF------ 464  Claviceps pur...
Q7SF57        445 WVLYCVFQFTQGD-SWAAKLLAGLTLGLFT-----------------------------------G---IlAFF------ 479  Neurospora cr...
XP_003347560  442 WVLYCVFQFTQGD-SWAAKVLAGVTLALFT-----------------------------------G---VlAFF------ 476  Sordaria macr...
KLU87740      434 WVLYCIFQFTHGD-SWAAKTLAGITLGLFT-----------------------------------G---VlVFF------ 468  Magnaporthiop...
XP_007789141  422 WALYSVYQFTHGD-SWAAQTLAGVTLAVFS-----------------------------------A---VlAFF------ 456  Eutypa lata U...
EME48537      562 tnveeqgvrrkdgengtsnvpFWKRMTSGGAVNSKR----SIHDDEDYTKKFGWLASRFRRTRWWFFTFWLFYEFIRAIF 637  Dothistroma s...
EMT61990      460 ---------------------TWKIFSTVRKLKSTEgnadALYNDKEIWVKYSLFYESYKKDYWWIFIPTIVYLFAKGCT 518  Fusarium oxys...
EJP64554      445 ---------------------AWKIYSTVQKLKAVEgdakGLYDDKELWTKYSLFYDAYSKGYWWLFIPVIVYMFAKGAC 503  Beauveria bas...
XP_006674730  441 ---------------------TWKIYSTVQKLKNAEgdvsGLYEDKALWTKYSLFYDAYRKNYWWLFIPVIFYMFAKGAC 499  Cordyceps mil...
EFY90929      461 ---------------------SWKIWSVVHKLKKQDgdaaAMYEDKKIWVKYSLFYESYKRQYWWLFVPAIFYMFAKGVA 519  Metarhizium a...
CCE30584      465 ---------------------TWKIWSVVHQLKQKEgdvdAMYSDKSIWVKYSLFYDAYKKQYWWLFVPTIFYTFAKGVA 523  Claviceps pur...
Q7SF57        480 ---------------------SYKIWSTARELKKREgdvaGLYNDKNIWVRYSLFYESYRKDYWWIFVPTIVYMFSKSVV 538  Neurospora cr...
XP_003347560  477 ---------------------SYKIWSTARKLKKLEgdigGLYDDKNIWVRYSLFYESYRRDYWWIFVPTILYMFSKSVV 535  Sordaria macr...
KLU87740      469 ---------------------SFKIWYTARQLRNVEgdasGLYEKKNIWVKYSMFYESYKKDYWWIFVPTIIYLFAKGTA 527  Magnaporthiop...
XP_007789141  457 ---------------------AWKIWSEVRKLKQREgdasGLYDDKATWTKYSLFYESYKRDYWWMFIPLIVYMFAKGTI 515  Eutypa lata U...
EME48537      638 YAGASGYAKAQVFGLLVVEILAFAFILWVRPFEGQRLNIIVVyCLGFSKVASVALSAAFDVEFNLQRITTTVIGIVIIVI 717  Dothistroma s...
EMT61990      519 LAVGDGNGMAQTIAQLVVESIFLCLLVWTRPFERKSSNIIGI-AIQTVRVLSVALILVFVHELKIPQDSKTIAGVVLIAV 597  Fusarium oxys...
EJP64554      504 IAAGDGHGMQQTIAQLVIEGCMLGLLLWSRPYERRSGNVLNI-IIQTIRVLSVACILIFVEEFGIAQTTKTVTGLVLIIV 582  Beauveria bas...
XP_006674730  500 IALGDGHGMQQSIAQLVIEACMLILLLWSRPFERRSGNVLNI-IIQTIRVLSVGCILIFVEEFGIAQTTKTVTGVVLIAV 578  Cordyceps mil...
EFY90929      520 IAAGDGHGMAQTIAQLVIEALMLCLLLWSRPFERRSGNVINI-VIQVVRFLSIACILVFVQEFGIKQTTQTVAGVVLIAV 598  Metarhizium a...
CCE30584      524 IAAGDGHGMAQTISQVVIEGLMLCLLLWSRPFERRSSNIINI-IIQTVRVLSICCILVFVEEFGIKQTTKTITGVVLIAV 602  Claviceps pur...
Q7SF57        539 LAGADGSGMVQTIAQLTIEGLMLCLLIWSRPYERKSGNVINI-MIQTVRVLSVVCILVFVEEFGIAQTTQTVTGVVLIAV 617  Neurospora cr...
XP_003347560  536 LAAADGSGMVQTIAQLSIEGLMLILLIWSRPYRGGAGNVINI-MIQTVRVLSVVCILIFVEEFGIQQTTQTVTGVVLIAI 614  Sordaria macr...
KLU87740      528 IAVGNGHGMIQTISLLVIEGIMLILLLWSRPYERKSGNVVNV-AIAVVRVLSVVVILVFVQEFGIAQTTQTVAGVVLIVI 606  Magnaporthiop...
XP_007789141  516 LASTDGNGLAQSIALMVVEGLMLGLLIWSKPFERKSSNVINI-TIQVVRVLSVVCILFFVEEFGVAETTQTVTGVVLISI 594  Eutypa lata U...
EME48537      718 QGFLTIITMIAIVVGAISSYMSVSRNQeDFRPrkWHSLREKYF 760  Dothistroma septosporum NZE10
EMT61990      598 QSALTGLLVILIIWNAINVLVKENPHR-KRRKe-MEKAKRD-M 637  Fusarium oxysporum f. sp. cubense race 4
EJP64554      583 QSTLTGLLAILVAWNAISACITANPHR-LRRKe-MEKRNRE-L 622  Beauveria bassiana ARSEF 2860
XP_006674730  579 QSTLTGVLAILIAWNAINACITANPHR-ARRKe-MEKRNRE-L 618  Cordyceps militaris CM01
EFY90929      599 QATLTAVLAILIAWNAINACCKMNPHR-KRRKe-AEQLKRD-M 638  Metarhizium acridum CQMa 102
CCE30584      603 QSTLTATLAILIVWNALTVCCTMNPHR-KRRKe-AEKIRRD-M 642  Claviceps purpurea 20.1
Q7SF57        618 QSTLTGILAILIVWNAINALCKANPHR-QKRKe-MEKL-QQ-R 656  Neurospora crassa
XP_003347560  615 QSTLTGILAILIVWNAVNACCKANPHV-KKRKe-MEEL-QS-R 653  Sordaria macrospora k-hell
KLU87740      607 QSVLTGILAILIAWNAISACCKANPHR-QRRKe-LEKM-RD-M 645  Magnaporthiopsis poae ATCC 64411
XP_007789141  595 QSALTGILALLIVWNAIIACVKMNPHR-QRRKe-MEKMQREGH 635  Eutypa lata UCREL1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap