Conserved Protein Domain Family
PhnJ

?
pfam06007: PhnJ 
Phosphonate metabolism protein PhnJ
This family consists of several bacterial phosphonate metabolism (PhnJ) sequences. The exact role that PhnJ plays in phosphonate utilisation is unknown.
Statistics
?
PSSM-Id: 399183
Aligned: 38 rows
Threshold Bit Score: 452.836
Threshold Setting Gi: 119959630
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q31DU9           17 AEYNFGFLDEYAKKEVRRSVLKAIAIPGYQVPYSSREMPMGRGFGTGGLQLTLALIGQKDTLKVIDQGSDDSVNAVNLRS 96  Hydrogenovib...
jgi:UWK_01535     2 nKQTFAFMDEDAKKEIRRSLLKAVALPGYTVPFASREMPVARGWGTGGLQITLSIILEQDVLKVIDQGCDGSVNAVNMRG 81  Desulfocapsa...
jgi:Arnit_0351    1 --mRYAFLDEDAKKEIRRATLKAVAIPGYIVSFASREMPIARGWGTGGIQLTLSLIKEDDTLKVIDQGCDGSVNAVNIRN 78  Arcobacter n...
Q10V10           26 PTYQFGFLDSFAKKEIRRSLLKAVAIPGYQVPYSSREMPIARGFGTGGLQITLSLLGKDDVLKVIDQGSDESVNAVNIRN 105 Trichodesmiu...
WP_012596997      6 HSYSFGFLDEYAKKEIRRSLLKAVAIPGYQVPYASREMPIARGFGTGGLQITLSIIGENDILKVIDQGSDESVNAVNIRQ 85  Rippkaea ori...
Q18H31           66 SGYNYAYLDEHTKREVRRSIIKAISIPGHQVPYASRPMPLARGWGTGGIQASLSLLGPDDTFKVIDQGSDESVNAANIRR 145 Haloquadratu...
jgi:Mvan_5870    18 rREAYAYLDEDTKRNVRRAILKALAIPGWQVPFASREMPVARGWGSGGLQVTLSLVGPADTVKVIDQGDDMSVNAAGMRK 97  Mycolicibact...
jgi:RoseRS_1588   7 RLYNFALLDEDAKREIRRSLLKAVALPGHLVPFASRDLPIARGWGTGGLQITMSIITPDDTPKVIDQGDDDSVNAVNLRR 86  Roseiflexus ...
WP_013076991      3 gVYNYAFIDENTKREVRRSLLKAVAIPGYQVPFGSRELPIARGWGTGGLHITLAIVGPSDIVKVIDQGDDDSVNACNLRE 82  Kyrpidia tus...
jgi:Desku_2259    8 SGYNFAFLDEQSKKEIRRRMLKAVAIPGYQVPFASRELPIARGWGTGGLQLTMSLIGPDDILKVIDQGSDDVVNAVNIRK 87  Desulfofundu...
Q31DU9           97 FIEMTCpGIDTTTKVTEANLIQSRHRIPEQPLREDQVLILQVPYPDALVVVESSEDKRKIMHGEADYSRLLVKLYEDIVK 176 Hydrogenovib...
jgi:UWK_01535    82 FITSVT-GVESVTETSRSTIIQTRHRIPEQELTEDHILVFQVPYPEVLTTVEPDTAQQKRMHGDGDYSKLWVLLYEDTSQ 160 Desulfocapsa...
jgi:Arnit_0351   79 FVTSVT-QNKTTTDTLKASLIQTRHRIPEEPLSEGQILVFQVPMPDILETVEPDTYKARVMHANADYSKLWVLLYEDTSL 157 Arcobacter n...
Q10V10          106 FISKTCpGVSLTKHTPEATIIQTRHRIPEFPLKLGQVLVLQVPYPDPLVIVEASEAKRKQMHGEGDYARLWVKLYEDMVK 185 Trichodesmiu...
WP_012596997     86 FIAKTCpGVTLTKNTQEATIIQTRHRIPEIPLKLGQILVLQVPYPDPLIVVESKEEKRKKMHSEGDYARLWVKLYEDIVQ 165 Rippkaea ori...
Q18H31          146 LASNTA-DVETTTDTTNADIIQTRHRIPEEVLTDEQILVLQVPVTDPLRKVDGSDAANRRRHAHRNYGKMWVHLYENVVE 224 Haloquadratu...
jgi:Mvan_5870    98 LISTSA-RCESTTSTAAATIIQSRHRIPEIDLRPDQLLVLQVPHPEPLRRVVPDDIAALAAHAERDYTAAWLDLYDAQAR 176 Mycolicibact...
jgi:RoseRS_1588  87 LITRTT-GVNTTVDTAEATIIQTRHRIPEESLRADQILVLQVPMADPLRWVEPNLERATVMHSEANYGKMWVYMYESVVR 165 Roseiflexus ...
WP_013076991     83 LIHDTT-GVTTTTDTRRATLIQTRHRIPEEKLTDRQILVLQVPYPEPLRWVEPSERETRRMHAERDYSKLWVFLYEDIVR 161 Kyrpidia tus...
jgi:Desku_2259   88 LLVLTT-GVRTTEDTREATLIQTRHRIPEEPLEDWQILVFQVPYPEPLRRVEPSEVKTREMHAEADYSRLWVYLYEDIVR 166 Desulfofundu...
Q31DU9          177 FNEITISHRYPTRINGHYVIDSSPIPRWDVPKMHQSKALILLGAGREKKIYAVPPYTLAEPLEFDDMPFRVENFNDenge 256 Hydrogenovib...
jgi:UWK_01535   161 FGDSRISNRYPVQVDGHYVMDPSPIPKYDIPRMDNSPALQLFGAGREKRIYAIPPYTEVKPLKFDDREFKVESFGNi--- 237 Desulfocapsa...
jgi:Arnit_0351  158 FGDSRISNRYPVIVENRYAMDPSPIPKYDTTKLGNSKALQLFGAGREKKIYAIPPYSDVKPLKFEDREFKVETFEDk--- 234 Arcobacter n...
Q10V10          186 FSEITISHRYPTRINGHYVIDPSPIPRFDVPKLHQSFGLHLFGAGREKKIYAVPPFTDAQPLCFEDIPFRVENFDDvdgr 265 Trichodesmiu...
WP_012596997    166 FSEITISHRYPTRINGFYVIDPSPIPRFDIPKLNHSHALYLFGAGREKKLYAIPPYTNTEPLSFSDIPFRIEDFLDetge 245 Rippkaea ori...
Q18H31          225 WGEINIAARYPTMVAGRYLMDPSPIPRWDVPKLDHADSLFIFAAGREARIYAVPPHTSVEPLAFEDRTFQVERFPGv--- 301 Haloquadratu...
jgi:Mvan_5870   177 LGGPRTGADHPVLVAGARLMSPSPIPRYDVLRLDRRPHPILLGAGRRARLTALPPYTTVQPLAFDDIALDPEDAEA---- 252 Mycolicibact...
jgi:RoseRS_1588 166 AGDLRIASQYPVLVNRRYLMDSTPIPRWDVPKLHMAETLYLFGAGREKRIYAVPPYTIVEPLQFDDYPFRTEYQPGq--- 242 Roseiflexus ...
WP_013076991    162 WGEITLSHRYPVMVNGRYVMDPTPIPRFDVPKLHRAETLFLFGAGREKRIYAIPPHTDVVPLQFEDYEFRVEDFDGr--- 238 Kyrpidia tus...
jgi:Desku_2259  167 WGEITIGAQYPVMVNGRYVMDPSPIPRWDVPRLNMAETLYLFGAGREKRIYAVPPHTRVEPLQFTDYPFRVEDFRGk--- 243 Desulfofundu...
Q31DU9          257 rqACHLCGCNHSFLDEFMDAKSGQKRY--QCSDSDYCHEQLI 296 Hydrogenovibrio crunogenus XCL-2
jgi:UWK_01535   238 --CCERCGASGVFFDEV--RIGSDKHF--FCSDTEFCDGNRG 273 Desulfocapsa sulfexigens DSM 10523
jgi:Arnit_0351  235 --HCKRCGNSGVFLDQV-YDKEGKVNY--YCSDTSYCDKILE 271 Arcobacter nitrofigilis DSM 7299
Q10V10          266 rrPCHRCGSTTSFLDEF-LDEQGNCIY--QCSDSDYCNTMLM 304 Trichodesmium erythraeum IMS101
WP_012596997    246 rrGCIRCGSKTSFLDEI-INNNGDKIY--QCSDTYYCSHQLN 284 Rippkaea orientalis
Q18H31          302 --SCHACGSTDTYLTEV-ETDDGSVYY--SCNDASFCHKRQQ 338 Haloquadratum walsbyi DSM 16790
jgi:Mvan_5870   253 --PCWLCGSTTSYRVPT-DGPSASQVW--CCSDADACHSRRE 289 Mycolicibacterium vanbaalenii PYR-1
jgi:RoseRS_1588 243 --RCARCGAEHTFLTHHFVADAGGGRWeaTCSDTAYCARRRA 282 Roseiflexus sp. RS-1
WP_013076991    239 --VCARCGQGGTYLTEVFDRETGEVNY--YCSDTSYCLKRQK 276 Kyrpidia tusciae
jgi:Desku_2259  244 --QCALCGSADTYLDEIIDDTTGARRY--ICSDTAYCAKRRR 281 Desulfofundulus kuznetsovii DSM 6115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap