5XZC


Conserved Protein Domain Family
DUF902

?
pfam06001: DUF902 
Domain of Unknown Function (DUF902)
This domain of unknown function is found in several transcriptional co-activators including the CREB-binding protein, which is an acetyltransferase that acetylates histones, giving a specific tag for transcriptional activation. This short domain is found to the C-terminus of bromodomains. The 40 residue domain contains four conserved cysteines suggesting that it may be stabilized by a zinc ion. In CREB this domain is to the N-terminus of another zinc binding PHD domain.
Statistics
?
PSSM-Id: 399179
Aligned: 14 rows
Threshold Bit Score: 75.8194
Threshold Setting Gi: 765553607
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5XZC_A        111 VMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQ 150 
EGD72148     1084 IMKRMGFCCGQELVFNPPTLYCNGKNLCTIPRESKYMSYR 1123 Salpingoeca rosetta
EDQ87803      708 VMKRLRFCCGKELTFNPQVLYCSVKQICPIRRDEEYMKYD 747  Monosiga brevicollis MX1
XP_002587794 2360 VMANLGFCCGRKYVFQPQALYCYGKSVCTIPWGARYWTYE 2399 Florida lancelet
Q1RLD3        333 VMQELGYCCGRKLEFMPMTLCCYGKALCTIQTGAVYYEYQ 372  vase tunicate
XP_003242232 1088 VMRSLGYCCGRKYTFNPQVLCCFGKQLCTIPRDAKYFSFE 1127 pea aphid
XP_009028895  110 aMISLGYCCGRRHVFSPQVLCCFGKQLCSIPRDTVYYNYl 149  Helobdella robusta
XP_009028884  107 VMRALGFCCGRKYMFSPQALCCYGKAMCSIPVNAVYYSHQ 146  Helobdella robusta
XP_009022290 1072 LMKSLGYCCGRYYYFNPQVLCCYGKPMCTIPVKASYFGYL 1111 Helobdella robusta
ESO09433      973 MMKSLGYCCGHKHIFSPIVLICYGKHMCTIPVNTYYYTYQ 1012 Helobdella robusta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap