Conserved Protein Domain Family
SbmA_BacA

?
pfam05992: SbmA_BacA 
SbmA/BacA-like family
The Rhizobium meliloti bacA gene encodes a function that is essential for bacterial differentiation into bacteroids within plant cells in the symbiosis between R. meliloti and alfalfa. An Escherichia coli homolog of BacA, SbmA, is implicated in the uptake of microcins and bleomycin. This family is likely to be a subfamily of the ABC transporter family.
Statistics
?
PSSM-Id: 399174
Aligned: 8 rows
Threshold Bit Score: 478.451
Threshold Setting Gi: 81641097
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q08120           84 PHRWQYWSVLGTALIIFNTYFSVQVSVAINAWYGPFYDLIQQALARTAPVTAGQLYSGMIGFSGIAFVAVTVGVLNLFFV 163 Sinorhizobiu...
Q2YMA1           84 PHPWQRWSILGSALILFATYFNVQVSVAINTWYGPFYDMVQKGLTTPGAVSAAEFYWGLADFAGIAFLAITIGVLNLFFV 163 Brucella abo...
Q6FDZ7           84 NNSWQRWSVWGTAFILFNIWFGVQTSVLVNAWYVPFWDLIQNMLTNGGG-NIIDLYKETLVFLYIAMVGVTLAVINSYFT 162 Acinetobacte...
Q4FLX3            7 QKEWRLWSWVGSFIILSSLWVQVQIDVKINEWFGQFYDMIQKALAAPNSITIGEYWASLLSFITLAGIYVALATVVAFFT 86  Candidatus P...
Q5DZQ3            8 NRKWFFWSIYGTTAVVAVNWFRVGIDVELNYWNGHFYDLIQEALVSPNAVKFVDFRNVIFDFFKITTMYVVISVVVDYFV 87  Aliivibrio f...
Q6AIY8            8 DKKWALWAYGGAIFLLLALFVQVELTVKINQWYGAFYDLLQKA----EEHTVDEFWASMKHFSFIAFPYVLIATLTSYFT 83  Desulfotalea...
IEC:ABF-0015597  80 PHPWQRWSILGTSLIIFVTYFSVEVGVAVNDWYVPFYDLIQKALSAPNAVTIQAFYQQLLIFLGIALTAVTVGVLNLFFV 159 Dickeya dada...
Q32JC4           80 PHRWQYWSILGTALIIFVTWFLVEVGVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFV 159 Shigella dys...
Q08120          164 SHYIFRWRTAMNEFYVAHWPRL-RHVEGASQRVQEDTMRFSSTVERLGVGLVSSIMTLIAFLPVLFKFSEQVNVLPIVGE 242 Sinorhizobiu...
Q2YMA1          164 SHYIFRWRTAMNDYYMSHWPKL-RHIEGAAQRVQEDTMRFSTTLEQLGVSLVKSVMTLIAFLPVLFTFSQKVSTLPIIGY 242 Brucella abo...
Q6FDZ7          163 SHYVFRWRTAMNDYYTAHWDQL-RHIEGASQRVQEDTMRFATIMEDLGVELVKAMMTLIAFLPLLFQLSKYVPVVPIVGE 241 Acinetobacte...
Q4FLX3           87 SHYLFRWRTAMIDWYHSVYDKA-RTIEGASQRVQEDTIKFSRIMEGLGTSFIEAIMMLVEFTPILFGLSVGIPIL-FFGD 164 Candidatus P...
Q5DZQ3           88 RHWIFRWRCAMNEHYTKHWPLI-RQIEGASQRIQEDTMRFAKLVEDLGISILRNFMTLATFIPLLWELSKHVKVIPFFGG 166 Aliivibrio f...
Q6AIY8           84 RIYSFKWREAMTFSYISKWQTVeEEVEGSSQRIQEDIYRFARIFESLGLQVTRAIMTLFAFLPILWGLSSGVD-LPYLRD 162 Desulfotalea...
IEC:ABF-0015597 160 SHYVFRWRTAMNDYYTSHWQAL-RHIEGAAQRIQEDTMRFASTVESLGVDLVKSLMTLIAFLPVLVSLSSHVKSLPLIGE 238 Dickeya dada...
Q32JC4          160 SHYVFRWRTAMNEYYMANWQQL-RHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPVLVTLSAHVPELPIIGH 238 Shigella dys...
Q08120          243 IPHALVWAAVFWSVFGTVFLAAVG--IKLPGLEFRNQRVEAAYRKELVYGEDH-EDRADPITLAQLFDNVRRNYFRLYFH 319 Sinorhizobiu...
Q2YMA1          243 VPHALVWAAVIWALFGTGFLALVG--IKLPGLEFNNQRVEAAYRKELVYGEDH-ADRAEPITMRELFKNVRHNYFRLYFH 319 Brucella abo...
Q6FDZ7          242 LDHSLVWAAIVWSLFGTVLLMVVG--IKLPGLQFNNQKVEAAYRKELVYGEDH-ADRAQPATLKELFSRVRTNYFRLYFH 318 Acinetobacte...
Q4FLX3          165 WNYGLVTGAFIWTVGGTLFLIVLGsiLRLVGVEYDLQKNEASYRKLLVIAEDN-IT-IRPKNLDELFNDVRKIHFKSYLR 242 Candidatus P...
Q5DZQ3          167 VEHSMVIVAVVSSFGGIAFLMFIG--RKLPAYEYNNQKVEAAFRKELVLGEDD-ESRATPKGLKELFDDVRHNYFSMYRA 243 Aliivibrio f...
Q6AIY8          163 IPGSLVWVALVVSLGGLVISWFVG--IKLPGLEYNNQKIEAAFRKELVYAEDDkVNYGKTCTLVELFVGLKFNYNRLFLH 240 Desulfotalea...
IEC:ABF-0015597 239 IPYGLVIAAVIWSLAGTGVLALIG--IKLPGLEFNNQRVEAAYRKELVYGEDD-ASRATPPTVKQLFGNVRKNYFRLYFH 315 Dickeya dada...
Q32JC4          239 IPYGLVIAAIVWSLMGTGLLAVVG--IKLPGLEFKNQRVEAAYRKELVYGEDD-ATRATPPTVRELFSAVRKNYFRLYFH 315 Shigella dys...
Q08120          320 YMYFNIARIFYLQADNLFGTFVLVPAIVAGKLTLGVMNQVLNVFGQVRESFQYLVNSWTTIVELLSIYKRLKAFESVL 397 Sinorhizobium ...
Q2YMA1          320 YVYFNVARIFYLQVDNIFPLIILIPSIVAGKLTLGLMSQITNVFDQVRGSFQYLVNSWTTIIELLSIYKRLRAFEAAI 397 Brucella abort...
Q6FDZ7          319 YAYFNLTATWYGQLDILYNLVVLFPSIAAGKLTLGLIQQIGGVFGKVRDSFQYLINSWKTIIELLSIRKRLKAFESIL 396 Acinetobacter ...
Q4FLX3          243 YFYFNLGRITYLQANVLSAYVFLAPAIVAGVVTLGVMQQIIRAFGRVEGSMQYIFRSWPTIIELASVYKRLKEFESKI 320 Candidatus Pel...
Q5DZQ3          244 YLWFDSCSSAYSKYSELTVYIFMSPTILQAAITLGVLKQITSSYSKVESSLRFLIRRWSSCVELMSIYKRLRAFEMQI 321 Aliivibrio fis...
Q6AIY8          241 YGYFDIWVNFFEQLMIITPYLIMATGLFTGLITLGVLVQVSNAFSKVRESFSIFIANWTTITELRSIHKRLREFEHNI 318 Desulfotalea p...
IEC:ABF-0015597 316 YTYFNIARVLYLQTDNIFGIIMLLPSIVAGSLTLGLMTQITNVFDQVRGSFQYLINSWTTIVELMSIYKRLRSFESVI 393 Dickeya dadant...
Q32JC4          316 YMYFNIARILYLQVDNVFGLFLLFPSIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHEL 393 Shigella dysen...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap