3ABS


Conserved Protein Domain Family
EutC

?
pfam05985: EutC 
Click on image for an interactive view with Cn3D
Ethanolamine ammonia-lyase light chain (EutC)
This family consists of several bacterial ethanolamine ammonia-lyase light chain (EutC) EC:4.3.1.7 sequences. Ethanolamine ammonia-lyase is a bacterial enzyme that catalyzes the adenosylcobalamin-dependent conversion of certain vicinal amino alcohols to oxo compounds and ammonia.
Statistics
?
PSSM-Id: 399169
Aligned: 163 rows
Threshold Bit Score: 169.921
Threshold Setting Gi: 502100595
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ABS_B               75 ADVLTELRRSTV--ARVCTGRAGPRPRTQALLRFLAD--HSRSKDTVLKEVPEEWVKAqGL-LeVRSEISDKNLYLTRPD 149 Escheric...
BAH43588             41 PEALEQAMKRTP--ARIGIGRAGTRMKTGSYLQFRID--QAAARDAVMKTISPELIESlQL-PvLHSRATSMEEYLMNLD 115 Brevibac...
jgi:Noca_4033       103 PSGLANLAASTA--ARIAVGRAGPRPRTESVLLFGAD--HAVTQDAIFGDVPTALLDQfGL-FaVQTKVTTQDEFLLRPD 177 Nocardio...
BAJ62754             64 SEGLRNLMSTTT--ARIGVGRAGPRPRTSTLLLFQSD--HGVTQDAIYGEVEQAVLDKfDL-FtVQTLVEDRNQYLTRPD 138 Anaeroli...
goetting:Tph_c06950  54 gnlkeVIKTSTS--ARLGVGRCGPRPLTDVLLSFLED--HAAAQDAIFIRVDSEFIKRlGL-IhLKTRVTDINEHLTRPD 128 Thermace...
ELY41313             15 ETALERIVGRSP--SRLGVGRRGTRPRTSSVLSFRAD--HARARDAVLTKVPNEVIEEnGL-LaIRSRISDQDEYLARPD 89  Halalkal...
jgi:Natoc_0230       37 EDALRRIADRTP--TRLGVGRSGPRPTTESLLAFRAD--HAVARDAVHSRVDDELLAElEL-VeLRTRVEDADQYLARPD 111 Natronoc...
CCB63556            484 EDEFERLRKNLP--AAYGFESAGPRPSEQVSRAIKAN--LAAAREAIYAEVTPERLAGiDF-RrVKTSAESKEIHLSHPD 558 Hyphomic...
Q4K5E3              482 diDFQRLLESTP--ATYGFDNAGPRPANSVSRTVRAN--LAVAREAIYVDLRPSEIGAiPL-ReLRTAAPDKLAHLQDPE 556 Pseudomo...
WP_015265002        523 ADGKNKIRAIRQrgVPIAEGYGDHIWDLEPQLAQQVQqlYDDAKISLWTEMPSSFIQGiPLaVpIVTQSKNRKDYVYHPE 602 Echinico...
3ABS_B              150 MGRRLCAEAVEALKAQCv----ANPDVQVVISDGLSTDAI--TVNYEEILPPLMAGLKQaGLKVG-TPFFVRYGRVKIED 222 Escheric...
BAH43588            116 SGRMLSDESARWLEQHGd----KNKDVQIVISDGLSTSAC--EATIPDLLPALIQGLSMrNVSVG-KPVFINKGRVWIQD 188 Brevibac...
jgi:Noca_4033       178 LGRELDDAAKLVVAEKCv----KGPQVQIVVGDGLSAAAV--TNNLPQIYPVLEAGLRDaGLTLG-TPFFVRYCRVGVIN 250 Nocardio...
BAJ62754            139 LGRKLSEEAKRIIAERCv----KKPQVQIVVGDGLSAAAI--NNNLPVIYPVILQGLKSaNISVG-TSFFIKYARVGVIN 211 Anaeroli...
goetting:Tph_c06950 129 LGRRLDEESEKILRAEGv----TEPQVQLIVADGLSSTAV--EKNVPELLPFLQKGLEKeGVKIG-KPVFVEFGRVGVID 201 Thermace...
ELY41313             90 LGRQLSEGTRSTIREECt----LDPDVQVVVCDGLSSTAV--EANVPDLLPTLVQGLEDrGFEVG-TPLFVRFGRVDVMD 162 Halalkal...
jgi:Natoc_0230      112 LGRELDAESRERLREECe----PEPEVQLIVSDGLSSTAV--EANVPELLPILRDGLADrGISVG-SPVFVEFGRVDVMD 184 Natronoc...
CCB63556            559 RGAKPADEM---IAELAp----ESVDVQIIVSDGLSAEAV--HHNIPDLLPALLDGLKEqSISAG-KPILAPYGRVKLAE 628 Hyphomic...
Q4K5E3              557 LGARLTEEV---LRRLKp----EYNDVQIVISDGLSAEAI--HHNIPELLPVLLDGLHSrELRIG-QPILAPYGRVKLAE 626 Pseudomo...
WP_015265002        603 TGEKLSHEAVKMLQKHManwqdETPDVQVVISDGLNARALmdSGHLDDYLKAIGPALSEnGFRVAeQPIVIRHGRVRAGY 682 Echinico...
3ABS_B              223 QIGEIL--------GAKVVILLVGERPG--LGQSESLSCYAVYSPRmA-----TTVEADR---------------TCISN 272 Escheric...
BAH43588            189 QVASIV--------NCKVVISLIGERPG--LATAESLSAYMIYKPD-A-----NTVESDR---------------TVISN 237 Brevibac...
jgi:Noca_4033       251 DINDIV--------GADVVVLLIGERPG--LGVADALSVYSGWRPT-A-----GKTDAHR---------------DVICM 299 Nocardio...
BAJ62754            212 DVNDII--------GADIVVILIGERPG--LGIADAMSAYMGWRPT-A-----GKTDAER---------------DVVCM 260 Anaeroli...
goetting:Tph_c06950 202 HIGEIV--------RAESAILLIGERPG--LATAESMSAYLEYEPR-L-----GKTDADR---------------IVISN 250 Thermace...
ELY41313            163 VIGETL--------GANVVVNLIGERPG--LNTAESLSAYLVYDPQ-P-----GEPTAKK---------------SVISN 211 Halalkal...
jgi:Natoc_0230      185 AIGEEL--------GADCCVILIGERPG--LGSAESLSAYLVYGPE-R-----GTATSKK---------------SVVSN 233 Natronoc...
CCB63556            629 ALGDAL--------QPKLVINLIGERPGgdALASRSMSAYIAYRLD---------DDAKKaaaqfsgnpdvryeyTVISN 691 Hyphomic...
Q4K5E3              627 SVGEAL--------QPQLIIVLIGERPGgdALASRSMSAYLGYRLP--------DEQARRaaaqfsgnadiryeyTVISN 690 Pseudomo...
WP_015265002        683 ACGELLfgstgtkeGCKGILHIIGERPG---SGHHNFSVYLTAAHP-AtwgqkGAIDHDIs--------------RVISG 744 Echinico...
3ABS_B              273 IH-QGGTPPVEAAAVIVDLAKRMLEQKASGINM 304 Escherichia coli K-12
BAH43588            238 IH-KGGTLPIEAGAYLAELLEEILMYQASGVKL 269 Brevibacillus brevis NBRC 100599
jgi:Noca_4033       300 ITqNGGTNPLEAGAFAVEHVKNVMKHQASGVEL 332 Nocardioides sp. JS614
BAJ62754            261 ITvHGGTNPLEGGAFVVDMIKKTLQYQASGVEL 293 Anaerolinea thermophila UNI-1
goetting:Tph_c06950 251 IH-ERGLSPAEAGAEILELIQKILRARQSGVga 282 Thermacetogenium phaeum DSM 12270
ELY41313            212 IH-ADGIPAVEAGAQIVDLVETIYETQASGVDL 243 Halalkalicoccus jeotgali B3
jgi:Natoc_0230      234 VH-DGGLPPVEAGAELVELIEDTLAAEASGIDL 265 Natronococcus occultus SP4
CCB63556            692 IY-AGGLPPSEAAVQIAERVNQILTTKAAGNRL 723 Hyphomicrobium sp. MC1
Q4K5E3              691 IY-SGGLPPLEGGSLVAEKAFAILHHRAAGNRL 722 Pseudomonas protegens Pf-5
WP_015265002        745 IS-DSSLQPKEAARQTSLILSQLFKkyeavs-- 774 Echinicola vietnamensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap