Conserved Protein Domain Family
Med7

?
pfam05983: Med7 
MED7 protein
This family consists of several eukaryotic proteins which are homologs of the yeast MED7 protein. Activation of gene transcription in metazoans is a multi-step process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators such as MED7 to direct transcriptional initiation by the RNA polymerase II apparatus.
Statistics
?
PSSM-Id: 399168
Aligned: 137 rows
Threshold Bit Score: 81.9094
Threshold Setting Gi: 303286417
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
GAC95404      55 TSFFPPPPQVYKNFTKRNLRYLDILNSHPladgepswdqldatqrlerqsailrqhtstsktsaqeqqdddvdmavveds 134 Pseudozyma hube...
EKC97575       9 nTLFPPPPEYYKAFTPEAVERLAELRSKDeggeere-------------------------------------------- 44  Trichosporon as...
P0CO76        14 nTLFPPPPPYFQAFTDEAIERYETLTGKSlfvndekgktkgkekksddrdmsv-----------------------diri 70  Cryptococcus ne...
XP_007410722   8 SSFFPAPPTRYLQFTKPNLTIAKSIQSKTkpnelqfdsdlqkrlikeslkdlk-----------------------diee 64  Melampsora lari...
Q5CSG5        11 VSSFPPPPPYFRLFDHEDKVAKIK-------------------------------------------------------- 34  Cryptosporidium...
EEA07886      11 VSAFPPPPPYYKLYNSEETALE---------------------------------------------------------- 32  Cryptosporidium...
XP_001610809   5 TSGYPLPPFFYKNYSFRNKNVTSSKVCMPttsltsnessed--------------------------------------- 45  Babesia bovis T2Bo
Q8IB55         7 VSGYPPPPYYYKEYQSVDIKKlmemsnfkstdeksflehmknsydviy-------------------------dvdtnty 61  Plasmodium falc...
XP_651043      3 aEKYLDPPHFIQEWESNDEST----------------------------------------------------------- 23  Entamoeba histo...
XP_001416123   5 aTPYPDPPAFFTLYGAPDVV------------------------------------------------------------ 24  Ostreococcus lu...
GAC95404     135 andqgsdelpdfdlkaelePPNVDwi-eeDGGYTVFGQLWPi----PDVMPSLEQLGIPVLYp----LEGTDRKELLLTL 205 Pseudozyma hube...
EKC97575      45 ------------rlqkeqdPPRTDwi-leDGRWMAFGQQYTa----TPHIPNARDIGLPALVadpvsQGGDSERSALPTL 107 Trichosporon as...
P0CO76        71 qdlteeeqneklelegkleKPRADwv-neDGRWMCFGTMYTt----EPIIPTAQSIGLPPFI-----DPAVEPQESLPPL 140 Cryptococcus ne...
XP_007410722  65 ideeeierineidlrtllePPNLDli-keRGGWSSFGDWEPw----PGKSSRAMLEGMPKLY-----EEKMERKDALQAL 134 Melampsora lari...
Q5CSG5        35 -------------------PPPCI-----EGPFTCFGSQLSs----DISIHPLDSDTI--LYn----ESNVDLPAELMML 80  Cryptosporidium...
EEA07886      33 -------------------SPPCI-----IGPFMCFGSILSs----EINIPPLDSDTS--LYn----QENSDLIQELRCL 78  Cryptosporidium...
XP_001610809  46 -------ilciidtvsgprYPSPP-----NSPWYSFGVEEKl----EFELHELDSETIINIP-----KKDNDLKKHFQIL 104 Babesia bovis T2Bo
Q8IB55        62 ikniesidnikncnfimgrPPPLPl----RNSYNVFGIDYEl----QRNIEELDSDEI--LY-----DEKKNLKEEFIRL 126 Plasmodium falc...
XP_651043     24 -------------------WPKPPaclgdDETYFSFNRTVK-----REETDLFPSEILDRTK---------DVRDQLKQL 70  Entamoeba histo...
XP_001416123  25 -------------------PPAPPtp-ptNAAYASFGANHHtapwhDPDHGYAASGGFVYPIcv-deRGKTDAREEMCAL 83  Ostreococcus lu...
GAC95404     206 LRTLLQTYREITGDLLKPaqpydvwvPaVPdpsltpeqqqqqmatnpgfwtqsteAKDR----LKHMQNVVVNMQFLINE 281 Pseudozyma hube...
EKC97575     108 LHSFLHTLLAFIDVLTGTar-----iPgELeaa--------------------grASEGdqqyIQHLSNLAATMIVSANQ 162 Trichosporon as...
P0CO76       141 LHSFLHTLLLLLDTLTMTar-----tPnELaa---------------------agWASEgdqyIQHLTNLSANMMVASNQ 194 Cryptococcus ne...
XP_007410722 135 LNTLIYSYLKLLNQLGHQg-------PpSLsnh--------------------snQVSNtdqiISHIELTSFNMHGLCNE 187 Melampsora lari...
Q5CSG5        81 NEMFQMEILKLLENSGKGv-----------------------------------vDTSS----VKKIIKIYNNMNHILEK 121 Cryptosporidium...
EEA07886      79 NSLFQENILNLFKKSGQGs-----------------------------------iEVSA----IKHIVKIHSNMNHILEK 119 Cryptosporidium...
XP_001610809 105 YGDFMDCFMHYLRHLKEV--------------------------------------DNDsvsdIKKLIKLYMNLQYVLYT 146 Babesia bovis T2Bo
Q8IB55       127 YKIYKETFFLLFDDIVNN--------RkDD--------------------------KSK----IKHLTKIHVNLFHILAK 168 Plasmodium falc...
XP_651043     71 NHSILVAYLAIISKQMNQ--------Ph---------------------------RYEVitpyVYHLRLLISTMHQALNS 115 Entamoeba histo...
XP_001416123  84 TRHATARFVEAMERCVDA--------Pt--------------------------rAEEA----TGALHALFNNAHKLINE 125 Ostreococcus lu...
GAC95404     282 -LRPVQAKETLKLIMQMQLERRKQETKLIRDKCESMRSRV 320 Pseudozyma hubeiensis SY62
EKC97575     163 -LRGVQAEETLVMLMEKQVSERKSQVEKLRAKNREVAEKI 201 Trichosporon asahii var. asahii CBS 8904
P0CO76       195 -LRSAQSEATLVLLMEKELEERRKQTEKLRSKCKEIASgi 233 Cryptococcus neoformans var. neoformans JEC21
XP_007410722 188 -LRPRQARETLKLMMKEQAKEKREKARLVLKTCEDLKNdl 226 Melampsora larici-populina 98AG31
Q5CSG5       122 -LRIIQTYHQICDELEAQVNEKNQLLDQMKQHLEEYKSLL 160 Cryptosporidium parvum
EEA07886     120 -LRLIQAYYLIMKQLELQIQEKKELIEQMRQLLTKCNEnt 158 Cryptosporidium muris RN66
XP_001610809 147 -FSERKAEYDVVRMLREQLYRRRHYIDCLKVALLDTERll 185 Babesia bovis T2Bo
Q8IB55       169 -LRHYQTINNIINVLKIQLKKRQIAIDKMKISLLNVYQYI 207 Plasmodium falciparum 3D7
XP_651043    116 -YRPYQAKKYYALLFEKQVEHKEKLYEQLKALIDDANNKy 154 Entamoeba histolytica HM-1:IMSS
XP_001416123 126 tIRPSQAMTDFEYQIERMIEEKRTSVEALERALERAKAVk 165 Ostreococcus lucimarinus CCE9901
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap