Conserved Protein Domain Family
Sbt_1

?
pfam05982: Sbt_1 
Na+-dependent bicarbonate transporter superfamily
Family of bacterial proteins that are likely to be part of the Na(+)-dependent bicarbonate transporter (sbt) family. Members carry 10TMS in a 5+5 duplicated structure. The loop between helices 5 and 6 in Synechocystis PCC6803 is likely to be the location for regulatory mechanisms governing the activation of the transporter.
Statistics
?
PSSM-Id: 399167
Aligned: 98 rows
Threshold Bit Score: 230.802
Threshold Setting Gi: 502938534
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Glo7428_3430  18 PTLAFLIGGIVIAALGSKLEIPDAIYKFIVFMLLIKIGLSGGIAIRNSNLTEMLLPALFAVVTGMLIVFIGRYTLAKLPG 97  Gloeocapsa ...
wustl:cce_2939    25 PTLGFLIGGAVAAAVSSRLAIPDAIYKFIVFMLLIKVGLKGGIAIRESNITEILLPALFAVLTGILIVFIARHTLAKLPN 104 Crocosphaer...
WP_015110058      18 PTLGFLIGGIIVAALGSQLAIPDSIYKFISFFLLMKIGLTGGIAIRNSNPTEIFLPALAAVGLGIVIVFIARYTLGKLPG 97  Cyanobium g...
jgi:GEI7407_1945  18 PTLGFLIGGMVIAALGSQLQIPDAIYKFIVFMLLIKVGLSGGIAIRNANLVDMLLPALFAVVMGILIVFIGRYTLAKLPK 97  Geitlerinem...
Q8YV47            18 PTLGFLIGGMVIAALGSELIIPEAICQIIVFMLLTKIGLTGGIAIRNSNLTEMVLPAASAVAVGVLVVFIARYTLAKLPK 97  Nostoc sp. ...
EAW46250          18 PTLGFLIGGMVVAAVNSRLQIPDAIYKFIVFMLLIKVGLSGGIAIRNADLAKMLLPAVFAVVVGILIVFIGRYTLAKLPK 97  Nodularia s...
jgi:PCC7418_0056  18 PTLGFLIGGMVVAALNSRLQIPDAIYKFIVFMLLIKVGLSGGIAIRNANLAQMLLPAVFAAIIGILIVFIACNTLAKLPK 97  Halothece s...
WP_024267853      18 PTLAFLIGGALIVAMGSRLSIPNSIYQFIIFLLLMRIGMKGGIEIRSAEIGEMLLPAVFSVAVGIIIVLLGTGFFSLLAR 97  Salinispira...
WP_014436046      18 PTLSFLLGGALLAAFGSKLTIPNPVYQFVVFVLLLKIGMKGGVEIREANLLAMLLPAVFSVVTGLLIVLLGQAVFARLPG 97  Phycisphaer...
jgi:Nmar_0485     14 PIILFFLFGIIAARIKSDLKIPAAISEFLPIYLLAAIGLHGGIEMRNTGFENMLIPMFVAIGLSLLFTLNHYQILRRLGK 93  Nitrosopumi...
jgi:Glo7428_3430  98 IRTVDAVATAGLFGAVSGSTLAAGITVLEAQGIEYEAWAGALYPFMDIPALVTAIVV-----ASIYTSKKKSLreqhrta 172 Gloeocapsa ...
wustl:cce_2939   105 IKVVDAIATGGLFGAVSGSTLAAGLAVLDAQGMEYEAWSAALYPFMDIPALVTAIVL-----ASIYTSKQKklaaeneyr 179 Crocosphaer...
WP_015110058      98 ISVPDAVATGGLFGAVSGSTLAAVLPQLDSAKIPYEAWTAALYPFMDIPALVTAIVV-----ASVYLSKKTgnta----- 167 Cyanobium g...
jgi:GEI7407_1945  98 VKTVDAIATAGLFGAVSGSTMAAALTLLEEQGVAYEPWAAALYPFMDIPALVTAIVV-----ASIYISKKRnaasedlnk 172 Geitlerinem...
Q8YV47            98 VNTVDAIATGGLFGAVSGSTMAAALTLLEEQKIQYEAWAAALYPFMDIPALVTAIVV-----ANIYLNKKKrsaageyls 172 Nostoc sp. ...
EAW46250          98 VKTVDAIATAGLFGAVSGSTLAAALTILETEGIEYEAWAAALYPFMDIPALVTAIVL-----ASIYTSKQRdtadeylsk 172 Nodularia s...
jgi:PCC7418_0056  98 IKTVDAIATGGLFGAVSGSTLAAGITMLESEGLQYEAWAAALYPFMDIPALVTAIVL-----ASIYVGKQRdtagevlsk 172 Halothece s...
WP_024267853      98 VRWSDGTATAGLFGAVSSSTLAAAMVLLEEQAVFFEAWVPALYPFMDIPALILAIVL-----SKLGTEKAGtrts----- 167 Salinispira...
WP_014436046      98 IRREDGLATAGLFGAVSASSLAAAIVMLEEQGIAFEAWVPALYPFMDIPALVLAIVL-----ATRHRQQAEgeagdang- 171 Phycisphaer...
jgi:Nmar_0485     94 FNLFDSYALASTYGAVGAVHFSVGLSFLKNQGVSSEGYIAAILAVLEPLAFILAIFMtnmavAKQIKTKKQSFsddstei 173 Nitrosopumi...
jgi:Glo7428_3430 173 gasfstagesfstasesfstagasfstagasfstagesfstagesfstageypskpeyptsrqeyrsqqritasgypskq 252 Gloeocapsa ...
wustl:cce_2939   180 skqefygeqkey-----------------------------------------------------gqqritasgypheeq 206 Crocosphaer...
WP_015110058         --------------------------------------------------------------------------------     Cyanobium g...
jgi:GEI7407_1945 173 qeffskqpvaagdysn---------------------------------------------pseypttrqeylsmqrgdg 207 Geitlerinem...
Q8YV47           173 kqsvaageypdqq---------------------------------------------------dypssrqeylrkqqsa 201 Nostoc sp. ...
EAW46250         173 qeysskq--------------------------------------------------------------aiiargypskq 190 Nodularia s...
jgi:PCC7418_0056 173 qeslskqrvaagevlsehgt-------------------------------------stgdyssvppeypttrqeyreqq 215 Halothece s...
WP_024267853         --------------------------------------------------------------------------------     Salinispira...
WP_014436046     172 -----------------------------------------------------------------------------ept 174 Phycisphaer...
jgi:Nmar_0485    174 di---------------------------------------------------------------------------gln 178 Nitrosopumi...
jgi:Glo7428_3430 253 rervkIWPIVKESLEGSALSALLLGLALGLLTRpE---SVFESFYEPLFRGLLSILMLVMGMEAWSRLGELRKVAQWYAL 329 Gloeocapsa ...
wustl:cce_2939   207 nhrveIWPIIKDSLQGSALSALLLGLALGLLTRpE---SVYESFYEPLFRGLLSILMIVMGMEATARINELRKVAQWYAV 283 Crocosphaer...
WP_015110058     168 -ekveVWPIIKESIQSSAVTSLLLGVALGILTKpE---PVYESFFNPLFRGFLAVLMIIMGMEAAQRMNELRKVAQWFAI 243 Cyanobium g...
jgi:GEI7407_1945 208 gnrveIWPIVKESLQGSALSALLLGLVLGLLTRpE---SVYESFYDPLFRGLLSILMLIMGMEAWSRLGELRKVAQWYAV 284 Geitlerinem...
Q8YV47           202 dnrvkIWPIVKESLQGPALSAMLLGIALGLFTQpE---SVYKSFYDPLFRGLLSILMLVMGMEAWSRIGELRKVAQWYVV 278 Nostoc sp. ...
EAW46250         191 hervkIWPIVKESLQGSALSALLLGLALGLLTRpE---SVYESFFNPLFRGLLSILMLVMGMEATARISELRRVGQWYAL 267 Nodularia s...
jgi:PCC7418_0056 216 gkrveIWPIVKESLQGSALSALLLGLALGILTRpE---SVYESFFNPLFRGLLSILMLVMGMEAWARISELRKVAQWYAV 292 Halothece s...
WP_024267853     168 -astrILDVIKESIQGPALSALVLGLALGIFARpE---SVLEGFYNPIFRGLLSVLMFILGMEAYSRIRELKQVAHWFAL 243 Salinispira...
WP_014436046     175 prkvdTWAIVKESLQGSALSALILGLALGLLARpE---SVLQSFYEPVFRGLLSVLMLVLGMEAWSRLRELKAVAHWFAL 251 Phycisphaer...
jgi:Nmar_0485    179 qtktkLSKVLHESITGKAIVILLGSIVIGYIIG-KdgfEPIKIVFDDMFTGAIVIFMIEMGIIAGQRLDDIKKVGVFLTA 257 Nitrosopumi...
jgi:Glo7428_3430 330 YALVAPLLHGFIAFGLGmiaHyATGFSPGGIALLAIIACSSSDISGPPTLRAGIPSANPSAYIGASTAIGTPVAIAIGIP 409 Gloeocapsa ...
wustl:cce_2939   284 YAFIAPLIHGFIAFGFGmiaHyATGFSAGGVVILAIIAASSSDISGPPTLRGGIPSANPSAYIGASTAVGTPVAIALGIP 363 Crocosphaer...
WP_015110058     244 YAFISPIVHGFLAFGVGviiHkLTGFSIGGAVVLAVIAASSSDISGPPTLRAGIPSANPSAYIGASTAIGTPVAIAICIP 323 Cyanobium g...
jgi:GEI7407_1945 285 YAVVAPLLHGFIAFGLGmiaHyATGFTPGGVVILAVIACSSSDISGPPTLRAGIPSANPSAYIGASTAIGTPIAIGIGIP 364 Geitlerinem...
Q8YV47           279 YSVVAPLVHGFIAFGLGmiaHyATGFSLGGVVILAVIAASSSDISGPPTLRAGIPSANPSAYIGASTAIGTPIAIGLAIP 358 Nostoc sp. ...
EAW46250         268 YAFVAPLLHGFIAFGFGmiaHyTTGFSLGGVVILAVIAASSSDISGPPTLRAGIPSANPSAYIGASTAVGTPVALALGIP 347 Nodularia s...
jgi:PCC7418_0056 293 YAFVAPLLHGLIGFGLGyvaHiTTGFSPGGVVILAVIASSSSDISGPPTLRAGIPKANPSAYIGSSTAVGTPIALAIGIP 372 Halothece s...
WP_024267853     244 YALAAPILHGLIGFALGyvaHiLAGFSPGGVVLLSVIAASNSDISGPPTLRAGIPSANPSTYIGASTSIGTPVAIGICIP 323 Salinispira...
WP_014436046     252 YALVGPVVHGLIAFGLGwiaHhAVGFSPGGVVLLAVIAASNSDISGPPTIRAGIPWANPSTYIGASTSVGTPVAIALCIP 331 Phycisphaer...
jgi:Nmar_0485    258 FAIIIPLFNGTIGVLVS---T-ALGLSVGGAVMFGLLMASASFIAAPAVLRHAIPQAKPSLYITSALGITFPFNIIVTLP 333 Nitrosopumi...
jgi:Glo7428_3430 410 LFVGLAQ 416 Gloeocapsa sp. PCC 7428
wustl:cce_2939   364 LFIGLGQ 370 Crocosphaera subtropica ATCC 51142
WP_015110058     324 LFIGIAE 330 Cyanobium gracile
jgi:GEI7407_1945 365 LYIGLAQ 371 Geitlerinema sp. PCC 7407
Q8YV47           359 LFLGLAQ 365 Nostoc sp. PCC 7120
EAW46250         348 LYIGLAQ 354 Nodularia spumigena CCY9414
jgi:PCC7418_0056 373 LFIGLAQ 379 Halothece sp. PCC 7418
WP_024267853     324 LFVSLAE 330 Salinispira pacifica
WP_014436046     332 LFAALGK 338 Phycisphaera mikurensis
jgi:Nmar_0485    334 ILFTLst 340 Nitrosopumilus maritimus SCM1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap