6B92


Conserved Protein Domain Family
Methyltransf_10

?
pfam05971: Methyltransf_10 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF890)
This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes. The function of this family is unknown.
Statistics
?
PSSM-Id: 399160
Aligned: 4 rows
Threshold Bit Score: 499.351
Threshold Setting Gi: 81540183
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6B92_A   4 MALSKSMHARNRYKDKPpDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSI-DIPLERLIPTV 82  human
Q9KRM2  43 AAVKSGLHPRNRHRGQY-DFPALIKVVPELQSHVMKNPKGQWTINFADPISVKLLNKALLVLHYGVTYwDIPEGFLCPPI 121 Vibrio cholerae O1 bi...
P75782   2 sAQKPGLHPRNRHHSRY-DLATLCQVNPELRQFLTLTPAGEQSVDFANPLAVKALNKALLAHFYAVANwDIPDGFLCPPV 80  Escherichia coli K-12
Q9HXG4  13 RKSASPLHPRNRHLGRY-DFPRLIAGSPELERFVILNPYGRQSIDFADPAAVKAFNRALLQQFYDVREwDIPDGYLCPPI 91  Pseudomonas aeruginos...
6B92_A  83 PLRLNYIHWVEDLIGHQDSDk-sT--LRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQN-NLSDLI 158 human
Q9KRM2 122 PGRADYIHRVADLLLKGNPQl--NhsQVRALDIGVGANCIYPIVGVTEYGWSWVGSDVDPVSIQQASLIVQSNsKLQGHI 199 Vibrio cholerae O1 bi...
P75782  81 PGRADYIHHLADLLAEASGTi-pA--NASILDIGVGANCIYPLIGVHEYGWRFTGSETSSQALSSAQAIISSNpGLNRAI 157 Escherichia coli K-12
Q9HXG4  92 PGRADYLHYLADLLGASHDGlipRgpGLRALDVGTGANCIYPLLGHHEYGWRFVGADIDPQSLASAAAILAANpRFAAAI 171 Pseudomonas aeruginos...
6B92_A 159 KVVKVPQKTLLMDALKEESEiIYDFCMCNPPFFANQLEAKGVNSRNPr---RP--------------PPSSVNTGGITEI 221 human
Q9KRM2 200 ECRLQKNSQHIFNGIIGANE-RYTVTTCNPPFHASLADAQQGTQRKLtn-lQAnqrkkgrlatptlsHSRLNFGGQKAEL 277 Vibrio cholerae O1 bi...
P75782 158 RLRRQKESGAIFNGIIHKNE-QYDATLCNPPFHDSAAAARAGSERKRrnlgLnkd-------------daLNFGGQQQEL 223 Escherichia coli K-12
Q9HXG4 172 ELRRQPDRRQIFQGLIGVDE-RFDMTLCNPPFHASLDEATRGSRRKWknlgKLdpt---------rtLPLLNFGGQGAEL 241 Pseudomonas aeruginos...
6B92_A 222 MAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRTMRWALAWSFYD 294 human
Q9KRM2 278 WCPGGEAAFIGKMAVESQQFAQQVLWFRTLISKGDNVRGMKKQLEKLGAQSIHVIEMAQGQKISRFIAWSFQN 350 Vibrio cholerae O1 biovar El...
P75782 224 WCEGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQKQSRFIAWTFMN 296 Escherichia coli K-12
Q9HXG4 242 YCEGGEAAFLAGMAEESRAFATQVFWFTTLVSKASNLPNLQERLKTLGASDIRVVDMAQGQKQSRFVAWTYLD 314 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap