Conserved Protein Domain Family
Bacillus_PapR

?
pfam05968: Bacillus_PapR 
Bacillus PapR protein
This family consists of the Bacillus species specific PapR protein. The papR gene belongs to the PlcR regulon and is located 70 bp downstream from plcR. It encodes a 48-amino-acid peptide. Disruption of the papR gene abolishes expression of the PlcR regulon, resulting in a large decrease in haemolysis and virulence in insect larvae. A processed form of PapR activates the PlcR regulon by allowing PlcR to bind to its DNA target. This activating mechanism is strain specific.
Statistics
?
PSSM-Id: 399157
Aligned: 2 rows
Threshold Bit Score: 65.875
Threshold Setting Gi: 1267802592
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012096314  1 MKKFLACSLVAVAMLAGVAFGVGQDQALTNQQEEVQLASDLPFEH 45  Bacillus cytotoxicus
WP_098543821  1 MKKFLACSLVAVAMLAGVAFGVSQEQALTNQQEQVQLASDIPFEH 45  Bacillus cereus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap