Conserved Protein Domain Family
T6SS_TssF

?
pfam05947: T6SS_TssF 
Type VI secretion system, TssF
This is a family of Gram-negative bacterial proteins that form part of the type VI pathogenicity secretion system (T6SS), including TssF. TssF is homologs to phage tail proteins and is required for proper assembly of the Hcp tube (the T6SS inner tube) in bacteria.
Statistics
?
PSSM-Id: 399147
Aligned: 108 rows
Threshold Bit Score: 190.51
Threshold Setting Gi: 336308418
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012591363          1 MNREFLDHYDRELKLLHEQAREFAEDYPGVAERLGGL-LDermDPMIGGLLEGAAFLAARVQLKLKHEFPEFTNNLLEQL 79  Methyloc...
WP_012986797          1 MKNNKESMYLRERAYMRELAQRVAKESPHLADFLLASh-----DPDIERVFEAFALLIAHLRDKLEDDFPEITHGILSRI 75  Xenorhab...
Q7MYS3                9 NMKNFEDFYREALSQIKHDLSNAAQEHPHLAPFTSESg-----DPDVLRLLEGFALTTAGIKQKIDDGFPEVINPLLRKV 83  Photorha...
WP_013203954          1 MEDDFLKYFDGEMRYLKEAGLEFSQAFPELGRTLGLDgSPvprDESVERLFQGFSLMMAKLRQKIDDDIPELTEPLLSHL 80  Erwinia ...
CAV18468              1 MTEPIMRYFEQELAFVRRSLGQFGQEYPTHAENLNIH-QGkieDPSMARLLDGVALLNAKVEKKLSEQLPEVIEGILSVL 79  Vibrio t...
JLExeter:vfu_B00789   1 MSDQLLSYFERELTYIRRALDGFGKDFPEHASSMRLN-QSsqeDPNISRLIDAVALLTAKTEKRMDEQFPEILQDLFHVL 79  Vibrio f...
WP_013659965          1 MSDQLLSYFERELAYVRRALDSFGSEFPDHAASMRLN-QTgqeDPNISRLIDAMALLTAKTEKRIDEQLPDVLQDLFSVL 79  Marinomo...
WP_002957595          1 MNNEDVFYYQKELSYLYQTREYFVKKFPKLAPFLALD-SK---DPDIERIIENLAILTSKIHQEMEQNIPYIAESLLNVV 76  Helicoba...
jgi:Runsl_5220        1 MYNDPKRYKTRE--YIRNEMIREVANLWNYDDSDVAIes---fDPLVGMLLGAFATSIEGIHHELDNSRSRIIRRLAHLL 75  Runella ...
WP_036827574          1 MVNKIGSYSKEA---IRARMLQNAVKIWKLKNIGSI-------DPFVKLLIDAFSTEIFKISNEMQASNKRIIEKLAGIL 70  Porphyro...
WP_012591363         80 VPD-YLAPTPSVLLLRA-EPPye-dAALR-DGQNIARGSYLEAVY-ReqDRq--VACRFRLASKITLLPFEITAAEYYGS 152 Methyloc...
WP_012986797         76 WPL-ALSPIPPTTVMQF-HPTd---GEHQ-GAVDIPAGTPVSAHV----NGqllT---FKTCRSLHIEPLIVLDRAVKKT 142 Xenorhab...
Q7MYS3               84 WPI-PLHPIPSTSIVQL-DMQp---GSMT-ETTSIAKGSEISAIQqN-------QSITFRTTQDISIEPITLIHKTLTHS 150 Photorha...
WP_013203954         81 LPV-INRTLPSIAVVEL-MPAa---PELHvREEVLPAESELYTQP-LgnDQ---QRCAYRTVRDLKLHPFALDSVAVFTL 151 Erwinia ...
CAV18468             80 YPS-YIQTVPSVAYLEL-HTEd---GPI--ESSSLPKGSLFSSTNtK-------NECLFKTVDELNIAPFNLSNARALSA 145 Vibrio t...
JLExeter:vfu_B00789  80 YPG-YLQIVPSYAPLSL-NLEd---NAVT-EAVVLPQGSEVAVAVnD-------AECRFTLAQALTIEPYVIAALRAESA 146 Vibrio f...
WP_013659965         80 YPG-YLQIIPSYTPLMV-ELGd---DPIT-ERVVLPKGSQASLMVkE-------AECLFSLAEDLIIEPFIIKDIQAESA 146 Marinomo...
WP_002957595         77 SPN-YTNPLPSLCMQEF-LLNk---DSKK-NKIIVPKGSRLQSITi---EQ---IECEFRTIYDVYLYPLDIDEVFMSSE 144 Helicoba...
jgi:Runsl_5220       76 TPDvLSGPQAAHAVMKVgIVD---------TSYTVSPQDIFTCNAsG-------KEFHFTPAGQYTLYNCKLAAQIIQNR 139 Runella ...
WP_036827574         71 TPSlYTCPQPAHAVVTT-LPIesteVLPEyTEFFTQRHLSSTFRDvSd-DT---IRISFTPVDTVRLVNMQVCSVLTNTM 145 Porphyro...
WP_012591363        153 PAPLQAlgvavg------aealagLKISLTHRsaaRVedeprdaeaaerpdLWfDGCR-------IN---ELPLHFLGPE 216 Methyloc...
WP_012986797        143 GTHSE-------------------IVLTLCQT---GI--------------PS-PVWQ-------SG---SLSFFLGTDS 175 Xenorhab...
Q7MYS3              151 GDKSL-------------------ISLTFQYHg-pTT--------------HW--KTG------------PVTLFLGEDQ 182 Photorha...
WP_013203954        152 QEGQQA------------------LRLRFTLPaltEI--------------RP-ADWQ------------NISLYLNGDR 186 Erwinia ...
CAV18468            146 PFSFNRpstan--------qssavVQISLSTGd-pDV--------------YF-SHLE-------LG---DLDFFVKGFE 191 Vibrio t...
JLExeter:vfu_B00789 147 PFNFPTpaglr--------raeavIQVELACSd-pSV--------------LF-SQLSl----------qHFDFYVRGFE 192 Vibrio f...
WP_013659965        147 PFNFPTpktvr--------raesvVQITLNCSd-pSV--------------FF-SQLDftssslgKDkndHFDFYVRGFE 202 Marinomo...
WP_002957595        145 KQYHTMd-----------------LRLKVNKP---DL--------------KI-CDIG-------LD---CLNLYLGDDI 179 Helicoba...
jgi:Runsl_5220      140 VKTLGSaprenfln---eilphneVWVGINMD-------------------SGpEEFD------------RLPFFFDWRN 185 Runella ...
WP_036827574        146 CYVFDEfqqkipfgkisgslahnsIMIGIDVS----M--------------CL-ENIP--------E---KLSLYCSNQA 195 Porphyro...
WP_012591363        217 PDAIALYEQIFASAAGVYFRYLDPFGDPVVVPAGtdII-EQIGFr--dDEALF-P-KNER-IFSGF-EWLREYFMFPRKF 289 Methyloc...
WP_012986797        176 EQAALLSLWLDQHISDVSLRVRG---EQRELSC------FPYGWhnlfDTPIL-P-MEKH-TYAGL-QSLIEYYALPQLY 242 Xenorhab...
Q7MYS3              183 KLASLLTKYIDQSLNNTYLKTSLK--EQ-EMWLS-----IEIAPr--lKENLVlP-RPHD-YFWPL-QVLYEYLYLPHVN 249 Photorha...
WP_013203954        187 VLQSALYLALSRQVKGIGVRFWQNATDLMPVDAT-----FMPRWqaeaDASLW-P-ESDSpALCGEvRPWLEYFTAPERY 259 Erwinia ...
CAV18468            192 NNADSLVDLLLNNTLSISISDSECA-QHSTVDNL--QL-KNRISd--lEFKFL-P-EHGN-QFTGY-QLINEFFFFKEKR 261 Vibrio t...
JLExeter:vfu_B00789 193 NSARGLVDMLLLNTEVLSVFDASG--QQRVVDAT--RL-KSRVAd--pDFHWL-PqYGNH--LGGF-DLLRDYFAYPDKA 261 Vibrio f...
WP_013659965        203 NSSRGLIDLLLLNTEAISLFDEQG--NQVEIDTK--RL-VSRAAd--pSFNWL-P-NHGN-HQIGF-DLVREYFAYPDKA 271 Marinomo...
WP_002957595        180 YTSATLLLFIHLYLEEVKIISCDTS-EKFKLNSC--NI-TTIGLe--pNESCL-N-YDDL-GFEAF-SLLREYFFIPEKF 249 Helicoba...
jgi:Runsl_5220      186 DPARRSYLPLLGDVR---------------------ML-TESGEelkiMPGLV-NiSPASgTADDF-DPTAQAERMTQRF 241 Runella ...
WP_036827574        196 FEDVDFVFKLLPFVK-------------VKCGDK--ELnVTKGLsyetSEASVlSgYEE--IFHEY-KIQTRIKENIKRI 257 Porphyro...
WP_012591363        290 L---GMRLTG--LRAILA----------RLP----ARNI-------DIIISFKELNPRl--QVAVTRNMFALYAAPAINL 341 Methyloc...
WP_012986797        243 N---FMTVDI--SDYCREv---------PLNa---DGTF-------ELIFRFEGELPL-----EDVDDAFMLGCVPAIHL 293 Xenorhab...
Q7MYS3              250 D---FMSFDL--SEEIAEl---------PLGe---DKQF-------TIILEFDCNIPI-----EDITPAFIPHCIPVINL 300 Photorha...
WP_013203954        260 F---FMQLQG--LETLTF----------PPD----TTSF-------DIEVTLSERWPY---DLSVPPDALRMHCVPVINL 310 Erwinia ...
CAV18468            262 Q---FFRLKN--FAEHAN----------KFD----ESEI-------VINLFMSSLPSEf--IRLFNKDVFKLNVVPAINL 313 Vibrio t...
JLExeter:vfu_B00789 262 A---YLRITD--LGQELM----------SFD----ANRV-------TLNFFVRQLPAEy--LRLFSRDVLALNTAPAINL 313 Vibrio f...
WP_013659965        272 A---YIRLEG--LYKELS----------RFQ----SSTV-------TLNFFVQQLPVEy--LRLFNRQVFLLNTTPAINL 323 Marinomo...
WP_002957595        250 N---FIRIQG--LDILKDc---------------qGSNL-------SIQFKFNKIFPK---NCIVRADLFSLSITPIVNI 299 Helicoba...
jgi:Runsl_5220      242 YnahFLSISNthRQTGQRivlqkkkhpeELAsllnPEELqki--flQELVWIKIRFPGgmaPDVLSRIVVDINAFPVLNR 319 Runella ...
WP_036827574        258 YdsrFIEISG--LTQDSIec-------eLPDnlkyDETVsasirsdRKILWLEVTFPTqftADIIEGFSFALNAFPVYNR 328 Porphyro...
WP_012591363        342 FEKTIDRVQVKSNQHEYHIVPDRSRYL-DYEPHRLLSVF--AHY--Rgg----aDAAPVRPLYSs-------eAEG-GAG 404 Methyloc...
WP_012986797        294 ENLTSLPIPLTPENHRYPLPLGESV-----RLFRLRDIQv-IQQ--PdekqqrgTPYRYLPIDQftpamgwlaEDG-EAD 364 Xenorhab...
Q7MYS3              301 APARTKPITFEKGKSRYVLEAN--------EIFSIDNIKlqSDPdgTs-----eGSAHSVPL-----------INSaQLA 356 Photorha...
WP_013203954        311 FRLLAQPLAVTTAVSDYRLRPHRLKDGhT-EIYAVNDVV--QVTed-------nTEFSYVPYSHfrhkggmlkYAK-SWP 379 Erwinia ...
CAV18468            314 FEQTGEPIPYDHRTLSVPVNADAHSDN-NIEIIEIQNVY--EITp--------nGEVPLIPLFKe-------kYSH-NQS 374 Vibrio t...
JLExeter:vfu_B00789 314 YAQYGDPIRYDFTRLSMPVVADTRAKN-ELTVVSVDEVN--EVLp--------tGEVPLSPNYEg-------gYWL-DDE 374 Vibrio f...
WP_013659965        324 YPQRGEPMRYDFTKLSIPVVADTQANN-ELTVVSVEKVC--EVLp--------tGEVELSPIYEg-------gYWF-DDS 384 Marinomo...
WP_002957595        300 FPKNAESIINDHTKDGYRIFVDRVHLD-SYEIIKINQVKa-HNS--Dsg---rrILKNYKSFERf-------eFLK-DNQ 364 Helicoba...
jgi:Runsl_5220      320 -RALRPTFDLRPLFNVFPINVEESD-----FFFGIIDIEtpMGI----------KLSNSRQF-----------TRD-STN 371 Runella ...
WP_036827574        329 -SWKSERTSLDIMGNTIPLLTDKYE-----HFLYVDKVEd-NAG----------HVYQDIPL-----------MQN-SHL 379 Porphyro...
WP_012591363        405 Al-hYAVRRMPrrrtaRENKYGassd----yvgTDMFIALVDNSRAGeer---------piaEL-SVTALCSNRH--LTE 467 Methyloc...
WP_012986797        365 Tf-yYLLQTARd----LPGRLT-------------HQLHFFDLTGRPav------------nLP-EIAVACHSWG--YHE 411 Xenorhab...
Q7MYS3              357 Ac-hFAEPGDNillfnHIREESpf-------ggNQINLTFYDHQAKPvte-------------hhYREFYCQYHRyhTQA 415 Photorha...
WP_013203954        380 Er-yYHTRLYR-----GPSGL------------NETILTLGGRTHAEqn-----------gvKM-RLNMTCTSGA--YPR 427 Erwinia ...
CAV18468            375 Yd-yWQSKHd------HFG--E-----------VSIAISLSDTTNTEfs------------kLL-GTKLLCTNGK--QAC 419 Vibrio t...
JLExeter:vfu_B00789 375 Sp-rWQIHQFWd----ERGRRQ-----------MDISVSYTELQPAQes------------vVL-SLRLHVCNGR--LPC 423 Vibrio f...
WP_013659965        385 Ap-kWQVRQFWd----EKGRRL-----------MDLSVSYGSEVTAQda------------vVL-SMSLKVCNGR--LPC 433 Marinomo...
WP_002957595        365 Ne-fYSINVKK-----NSKGET-----------YKEISFFSGHSYNE---------------II-TIDALCCNKN--LPS 409 Helicoba...
jgi:Runsl_5220      372 Q---YLLRQGGvarfdERDASEmisyltdllrdESAMFMALGRGSLEtdie-------eirkHLeRINKDLKKDS--FPN 439 Runella ...
WP_036827574        380 GqglYTVRKGGmerfdERNAIDmmenvlelirdEVSAFSVYKRDDVTeavkkmilqmklleqET-LQADKRIKQE--VNY 456 Porphyro...
WP_012591363        468 Q-L--PVGq--GGADFR-LIDNt-AID-LRCIAGPTRPREPIIAqlrsrsesayaGKVTWRLINLLSLNHLGLVERgagr 539 Methyloc...
WP_012986797        412 QaI--ALEk-gTLTVMQ-EGSP--SHLnVHNITPVATDYPSMLQ-----------DNSGWPLLSCLSSPPMLLFTT---- 470 Xenorhab...
Q7MYS3              416 RtL--------GIGQICiPSEQipSHIqARNIVAASKDLPAVVN-----------SHQHWPILSLLSIGPFFLSHI---- 472 Photorha...
WP_013203954        428 MaL--QAS---VYDGDM-APSN--LELkCATRTRPSMPYYPLTD-----------ALYQWQVLSLLHPQAIAGLMEi--- 485 Erwinia ...
CAV18468            420 G-V---------IGTLE-CLESidLPGdFSPIYPPSAPIKKEID-----------QNIHWEFISLLNTNFTSLVQSsn-- 475 Vibrio t...
JLExeter:vfu_B00789 424 L-I--P-----ANAVME-SLAAidLPGdLKLLKTPTAPQYPPLD-----------NQLSWRFVAMLNANFSGLIQNed-- 481 Vibrio f...
WP_013659965        434 L-V--P-----SYSHAE-SYAAvdIPGeLKNVRTPTAPQYPALD-----------NQLSWRFVAMLNANFSSLTQAdd-- 491 Marinomo...
WP_002957595        410 K-L--KIG---DIRHI--NFEDi----sTKNIKIPSMMREYSVD-----------GHLLWKLVSILSFNYQSILNT---- 462 Helicoba...
jgi:Runsl_5220      440 WfV--SVKtaeKSGRIV-LNYWvtKADlANNIAFNTK-----LN-----------RDRANKAFNDEMTVFLTTTQGg--- 497 Runella ...
WP_036827574        457 ViInsSES---KSNYFE-ASYWvtHCStANNIRATTVLKP--LK----------------RVVAGATRDLILLTDTvg-- 512 Porphyro...
WP_012591363        540 naQALRETVSMFAD------LSDSATERRIRGLRSVDSRPIVRRIrqsgGVGVARGVEVTVTIDEKAFEGSG-AFLLGAI 612 Methyloc...
WP_012986797        471 --ESLKHFLRLFDPyaelnrPLSRHIRRHIDGIVRVEERLTDRMYk---G-RPVRGHLLSLTLNPDGYANPGeMYRFCRL 544 Xenorhab...
Q7MYS3              473 --ESVRSLVKQLDTfahldaPRSRHIQRMADGLSAIYLEPYYHFDk---G-IPVRGQAITLRMTPENYEHEGeMYAFAKT 546 Photorha...
WP_013203954        486 --GTLRHALGLLDW------TNSAGNARRIAGITHVEYDPSHYPAe---G-W--HGVAIRITLDETQFCGQGdALLFSEV 551 Erwinia ...
CAV18468            476 pvAELKHMLSLC--------SRDQVSSTEIQMIHSITFNSQVSAIrvlgKNVFSPGTEIELTLDAT---SP--YLAFADV 542 Vibrio t...
JLExeter:vfu_B00789 482 ptRMLQDVLRLC--------S-NSAQCAVADAIKKVAYNHVVAPLtingRSIFASGTEVMILIDDELLDSN--FAVVSEV 550 Vibrio f...
WP_013659965        492 atRALQDVLRLS--------T-HSIQCKVADSIKNVSYKHLVAPItidrQSIFASGTQVTILIDDELLGAD--FAVVSNV 560 Marinomo...
WP_002957595        463 --TSFFGVLESYSFvn--dkENEETYKRLKNSIAYIESKSTYLVd----EYITKKGTLCIMGIKDSNFYSLGeVYKLGLI 534 Helicoba...
jgi:Runsl_5220      498 -qRPLQGDEYLPVFrkalltRGRIVTFEDYKAVCMSELGNQISEV------NVKKGFGVGSAQDQGLQQTVD-IYLTPNP 569 Runella ...
WP_036827574        513 gnPEQKGTDAIEAYkyalttRDRIITKEDIKNYCRLTLQNELKTV------EVKRGMIISDIPQEGFVRTTE-----IEI 581 Porphyro...
WP_012591363        613 LDRFYC-EYAGFN-HFTQTVIRSVDRGE-IMRWPVRAGLR 649 Methylocella silvestris
WP_012986797        545 INQAMA-CFVGQS-TFVKLNVYTPNCHKaLWEFWEVYGLR 582 Xenorhabdus bovienii
Q7MYS3              547 LHTAFSlCFVET--SFHRLTVINNGTNE-CWEFYNMPGHQ 583 Photorhabdus laumondii subsp. laumondii
WP_013203954        552 LEQFYT-QYADIR-RFTQLTVTLSHSGR-QWVWPERRLTR 588 Erwinia billingiae
CAV18468            543 LNRFFQ-QFCSFD-RYIQLKIRLYGRDGfIKTYPKIHGSQ 580 Vibrio tasmaniensis LGP32
JLExeter:vfu_B00789 551 LNAYFR-QYCSFD-RFVQVSVERFGSDEaGIHFDKTHGSQ 588 Vibrio furnissii NCTC 11218
WP_013659965        561 LNGFYQ-QYCSFD-RFMQVNVERFGSDVpGIEFEKCHGSQ 598 Marinomonas mediterranea
WP_002957595        535 ISKFFA-SFVSIN-SFCELKIKCLDSKE-ILYYPATRGKK 571 Helicobacter cinaedi
jgi:Runsl_5220      570 LKPQSReQWGELK-ARLLNSLEDQSSGI----FPIRIFVH 604 Runella slithyformis DSM 19594
WP_036827574        582 VPQNYA-EYGKTYwDKMAVSLKSQIESKaIDGVEYIVRII 620 Porphyromonadaceae bacterium COT-184 OH4590
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap