5N8N,3J9O


Conserved Protein Domain Family
VipB

?
pfam05943: VipB 
Type VI secretion protein, EvpB/VC_A0108, tail sheath
EvpB is a family of Gram-negative probable type VI secretion system components of the tail sheath. They have been known as COG:COG3517. These sheath-components, of which there are many copies in the sheath, are also variously referred to as VipA/VipB and TssB/TssC. On contact with another bacterial cell the sheath contracts and pushes the puncturing device and tube through the cell envelope and punches the target bacterial cell.
Statistics
?
PSSM-Id: 399145
Aligned: 107 rows
Threshold Bit Score: 315.982
Threshold Setting Gi: 218322340
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5N8N_B               31 ESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLK-KfkG-TTWDQSPIFK 108
WP_013261288        187 elIVTDVAATLNELLNAILHHPRFQKLEASWRSLHLLTQTAGDHPETQISFLPAHLPNLREDLS-R--A-PTLADSHLFD 262 gamma pr...
ABM01893            149 elVVCELELILSRILNQILHQADWQQLEASWRGIYWLCQTAESSHSLIIECASATKQLLWDDLF-T--N-TDLLDSNLYQ 224 Psychrom...
Q5NEC4               82 QKVITVIDKLIDLQVNSIISNDEFRALEQEWLKVQEVCQED--YDNVEVSILDVKKEELQYDFErN--L-YDISSSDFFK 156 Francise...
jgi:Hoch_3044        85 DTLITQIDGEVDDMLHRVMRGPTLKMLEANWHSLDDLSRQVE-SEEVVVDFLDVTKEELAVDLEdH--S-SYILNSALFR 160 Haliangi...
Q09CG0               76 MKAIARIDGLIESQMNEILHAEEFQTMEASWRGLEDLVNHTNFQADITIDILDVAKEELSEDFEkN--S-SNIFSSALFD 152 Stigmate...
WP_014396953         74 lDVISRIDRMIDAQMNEILHNETFQKLESTWRGLEDLVDHTNFKANIAIDILDVAKDELAEDFEnN--S-SNIFAGALFD 150 Coralloc...
CAV18472             67 STLISKIDTALSLQLDAIIQEPDFQKLERNWLSLQQLVSLPISYQRAHVKLLDMNWTEISSDVN-Q--A-YSTKSSDLYN 142 Vibrio t...
JLExeter:vfu_B00791  47 lRLIAEIDDRMSRQLSTIIHHPDFSRLEASWKGVEALVSLPVNYQKVQIKIRNMSWEDLSQELN-T--A-VSLRRTSLYN 122 Vibrio f...
3J9O_B               74 QKVITVIDKLIDLQVNSIISNDEFRALEQEWLKVQEVCQ--EDYDNVEVSILDVKKEELQYDFE-R--NlYDISSSDFFK 148
5N8N_B              109 KLYEEEYGQFGGEPYGCLVGDYYFDQSP------PDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKI 182
WP_013261288        263 VLYTHEYGQFGGKPYGALIVDHAFDLHT------DDLQLLRRLAQLGSIAHAPILTQVAPTFFGVNDYGELAQLDSLASI 336 gamma pr...
ABM01893            225 QVYVDSIGQYGAVPYGVLLIDDYFSGAG------SDLTLLKAITEVCSKAHLPVVTGANARMFDVNDFNTLQDSDYISEI 298 Psychrom...
Q5NEC4              157 KVYVSEFDQYGGEPYGAILGLYNFENTT------NDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDLSEITHIKSFEAL 230 Francise...
jgi:Hoch_3044       161 KVYVDEYDQFGGKPFGCMVSLDYFDSSD------EDLDWLRTMSLVGAAAHCPFIAGVKPGFFGVQSWNELDRESDLEAL 234 Haliangi...
Q09CG0              153 KMYIKEYDQFGGKPYGVMLGLYEFSASR------ADLTWLERMGKVANAAHCPFVSAVSPKFFDCESIEQLESLKNLDGV 226 Stigmate...
WP_014396953        151 KVYIQEYDQYGGRPFGAIVGLYDFSSTP------ADLTWLQRMAKVSNAAHAPFISAVNHKFFGCETIEEMEAIKNLEGV 224 Coralloc...
CAV18472            143 KIGNSELNTLGGHPFGCITFSHPISMDIdfdanyDDLFTVELLGKLGEATLCPMLFSPVPTFFGENGADWLSDITRINKI 222 Vibrio t...
JLExeter:vfu_B00791 123 LIGNRELNTSGGQPFGLVVVDHALSMSLdg--dyDDLYTLELLSQLGDLCLCPFILSPSDDFFGESGADWFSDIERVKKI 200 Vibrio f...
3J9O_B              149 KVYVSEFDQYGGEPYGAILGLYNFENTT------NDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDLSEITHIKSFEAL 222
5N8N_B              183 FTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDP-V-----E---EFA-FEEEtDGAD-SSK-YAWANSAYAMA 250
WP_013261288        337 PNGDRYIHWRALKASPEANYLVLTLPRILLRAPWS-TRTGnV-----P---SLL-FEED-IDSS-THA-LLWGNAAYALG 403 gamma pr...
ABM01893            299 HAGHRYIKWRNFISTEEASFLALTMPRLLFRNAYG-KGDS-----------ALSwFQEN-IGDS-HED-CLWGNASFGFV 363 Psychrom...
Q5NEC4              231 LEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNP-V-----QyklMEG-FNEF-VDYD-KNEsYLWGPASIHLV 301 Francise...
jgi:Hoch_3044       235 MSLPKFSAWNSFRESDAAAYIGLTLPRYMLRRPWEGKRQG-----------TVT-FNE--KIRN-ADD-YLWGSAAILLA 298 Haliangi...
Q09CG0              227 LSHPRYSKWMELRDKEEAAYIGLTLPRYVVRLPWDPDRNP-C-----D---VLN-FKED-AEGD-SKK-YLWGNASYLMG 293 Stigmate...
WP_014396953        225 LAHPRFGRWNAFRDTEEAAYVGLTFPRYVLRLPWHPDKNP-C-----D---VLN-FTET-ARGD-SDK-YLWGNSAILLA 291 Coralloc...
CAV18472            223 LSGPDFKAWQDLRSKPSSRFIGMALPQVRLRDAYK-NRRV-----------GFV-YNE-----Q-GKG--SWGLANMVLA 281 Vibrio t...
JLExeter:vfu_B00791 201 LHGPEFVAWQRVRRLSSARFIGLVVPKIRLREAYGRSASS-----------AIQ-FRE--YSAN-PAG--LWGSAAYLFA 263 Vibrio f...
3J9O_B              223 LEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNP-VqyklmE---GFN---EF-VDYDkNES-YLWGPASIHLV 293
5N8N_B              251 VNINRSFKLYGWCSRIRGVE----SGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTDFAA 326
WP_013261288        404 TCMLRSFQQFGICTDLTGEH-----GGAVTCLPPLPLKNTHSTL---LPVEVILSETKEAELIHQGFTPISIAKAQEKIL 475 gamma pr...
ABM01893            364 DNLLKSFQESGFCTFISGME-----GGRLNLS-------ALLNKSPNLPIEIAFSEEKEAELIKLGFNPVCTRAYHNILL 431 Psychrom...
Q5NEC4              302 KNMMRSYDKTRWFQYIRGVE----SGGYVKNLVACVYDN-KGILETKSPLNVLFADYMELSLANIGLIPFVSEKGTSNAC 376 Francise...
jgi:Hoch_3044       299 RNMIRSFENSGWCQHIAGPR----GGGLVRNLPVHTIMH-HGHEELQPPVEFTLPDYRELQFSRAGFMPVVYQKGTADVC 373 Haliangi...
Q09CG0              294 RNLVKAFEQSGWCQSIRGPK----GGGLVTGLPVDTFTL-RGQKMIQAPVEIAIPDYREYEFARNGFIPLVHRKGSSEAT 368 Stigmate...
WP_014396953        292 RNMVKAFEISGWCQSIRGPK----GGGLISGLPVDTFSL-RGQEEIKAPVEIAIPDYREYEFARSGFIPLVYRKGSSDAT 366 Coralloc...
CAV18472            282 TTIMREFHRVNWFGFLKSRWndklQGSVINLPASHYFDS----HLQKPVADVSLFGQLSNFYAQSGFIPLTKSPLTDKFY 357 Vibrio t...
JLExeter:vfu_B00791 264 SVAIREFNRINWFGFMKSRWqdkyYGSLGNVPPGGAGVS----ATLRPTPDIRLITEMGTFYADEGFIPLCHSLTTDKYF 339 Vibrio f...
3J9O_B              294 KNMMRSYDKTRWFQYIRGVE----SGGYVKNLVACVYDN-KGILETKSPLNVLFADYMELSLANIGLIPFVSEKGTSNAC 368
5N8N_B              327 FIGAQSLQ 334
WP_013261288        476 FRAANAIH 483 gamma proteobacterium HdN1
ABM01893            432 FESANSVR 439 Psychromonas ingrahamii 37
Q5NEC4              377 FFSVNSAK 384 Francisella tularensis subsp. tularensis
jgi:Hoch_3044       374 FFSTQSVK 381 Haliangium ochraceum DSM 14365
Q09CG0              369 FFSTQSIK 376 Stigmatella aurantiaca DW4/3-1
WP_014396953        367 FFSTQSAK 374 Corallococcus coralloides
CAV18472            358 FNGNNSIW 365 Vibrio tasmaniensis LGP32
JLExeter:vfu_B00791 340 FRGNNSIW 347 Vibrio furnissii NCTC 11218
3J9O_B              369 FFSVNSAK 376
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap