Conserved Protein Domain Family
T6SS_VasE

?
pfam05936: T6SS_VasE 
Bacterial Type VI secretion, VC_A0110, EvfL, ImpJ, VasE
T6SS_VasE is a family of of bacterial proteins that are essential for the type VI pathogenic secretion system, although the exact function of this particular component of the system is still not known.
Statistics
?
PSSM-Id: 399140
Aligned: 141 rows
Threshold Bit Score: 200.109
Threshold Setting Gi: 502590512
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA194094:J421_5497   8 FQAQRRHFEEGLALALDTLFAFAHGVSAAALDADALANGTLALDHARGVLPDGTPFLIPEAD-PAPPPEPLAErfSptRD 86  Gemmat...
WP_011768449           20 FQQLDRYTSTMSNLYSKVRSGVESGISELKFDLSALKTGLLVIEKLECILEDGSLLLYPGNCqIPPLRLDKEQ--FddSG 97  Psychr...
WP_013261291           20 LQYADQYHRDFATALVAHTRPHHSGLIELDIDQDALRSGAFQCKQIEALFPCGTWICFPGNAiLPPRNFETYW--VdrKQ 97  gamma ...
WP_014260279           20 FQLLDRYHESLLNPLRQYLRPYFWGVISLEIHEAALSNARFELSKGEFLFPDGELVSYPGNAlLRPRSFEAEW--TdfQR 97  Desulf...
jgi:Desal_0433         20 FQLSDLHQLHRFRAMRQYGLPYFWGVSGLKVREGALERKKFEVTEIEVFFDDGNLVTFPGNAhIEPRSFEDAW--EegGK 97  Desulf...
WP_014450442           20 FQLTDAHTTGMTRPVLDTVLPFGWGVQTIDIQTTALGRGSVQVNSLSMVLQDGSFVQFPGNAvIRPRSFEKDW--TyrDK 97  Leptos...
Q3A0R3                 17 FQAWDKQLENSQQLRQFLLNPFSWGIMSLSIDHEALKLGRFQLLEASCIFQDARMVHYQSSV-HAPLTCDLHSp---gGE 92  Peloba...
jgi:Marme_3676         22 FQAWDAYQEKIQSLRTKIYEPHFWGVKDVSWDKAALENGRLVLTQCLAVLPNGQIIDYDRNR-DTPVHLELGDl---sRL 97  Marino...
jgi:Hhal_0165          23 FQCWERYLEAAQARRLSAVTPHAYGLLGLVVEEAPLEQGVLRLQACQALLPDGRLVAHGHGD---PLELDLTGs---sGQ 96  Halorh...
WP_025280153           20 FQAWDRYHEQALIERFRITHPRSWGLHRLRLDPDAPAMGICRILELEAILPDGRLVTVDPFD-DAPLACELPDa---aRE 95  Ectoth...
PRJNA194094:J421_5497  87 AHVVHLAIPAWRGDGANVTdpSAGPDFdappnghdARYVAVAAP--VRDET-TGLDsAPVRFAAKNLRLLLDEELA--PD 161 Gemmat...
WP_011768449           98 NLNIFIALAPISAEQNNLVsnSSPD----------ARFKLAADIn-kKDLFdNNEQ-ATLSMLDFNCNLVPSYNLKstAG 165 Psychr...
WP_013261291           98 NLTVWLALKRLLPGDTNLTvtGSRHESas----akTRYVTSNTGteYPDNFqNSGS-AQVKPIDYVLQFCFGNEPEdlEE 172 gamma ...
WP_014260279           98 PFKVYLGLRRQDSQDGNVEviDGPDGLad----mpKRYTSRSGPeeAGDQYgQGPV-AQVRFLNYGLRLFWESELEraQN 172 Desulf...
jgi:Desal_0433         98 PFTVYLGLRKWNPEGGNVAqvE--DTAas----vnTMYAVSPDPveQPDLLgSGPA-AQIKPMRYVLRLFWENELDdlGA 170 Desulf...
WP_014450442           98 PLTIYAGLRRFRDQGKNVTtvPNLDSDa------dTRFLSLADPeeVQDLYgEGPP-ASVKTLYFNVRLFWDNEIDnlEH 170 Leptos...
Q3A0R3                 93 TLGIYLALPANNHVD-SISgyPQRSQI--------SGWVADYQE--IEDSFdASRK-REILLAQPNLHLLSDQEAL--GP 158 Peloba...
jgi:Marme_3676         98 ELDVQLTIADSDNVD------TITGYNaq----gnAAWNSEYVD--VADCFdSNRK-REVLLAQPNLNLIESGTQS--NR 162 Marino...
jgi:Hhal_0165          97 EGVVYLTLPRNNRVR---------DLPgyadggssAAWRPRFVQ--LADQHdEQRE-REVLLADPELALGTQPPS---GA 161 Halorh...
WP_025280153           96 PVVVYLLLTRERRALg----mTGYEAAgh----rrGAWQVDYVE--LADEHdTQRQ-QEVALGRLNLILGTETPAD--PD 162 Ectoth...
PRJNA194094:J421_5497 162 DVSLPLARVRRDGAGRFVL-DPDFVPPCLQIGASERLLGLLRGVVGMLEAKGATLAatlaattaTAAPAPNATGGPAAyv 240 Gemmat...
WP_011768449          166 LSLLKVAEIFLS-VDQCTP-SETFIPKITLLSGSEVLKNLVKSTKQSLVGRFEQLQn------iTSFESGLVN--SSN-- 233 Psychr...
WP_013261291          173 YIFLPVAEITQE-GKEYRI-SEHFIPPCINIGASRAITNTLLTLKSNLMGRARLLEs------yKSSGANDRTALSNA-- 242 gamma ...
WP_014260279          173 YSLLPIASLERD-GGEVRV-CRRYIPPCLTLSACGLLREMVRGLKDQLVSRCRQLEe------yKSPREVQVSALDAG-- 242 Desulf...
jgi:Desal_0433        171 YNIIPLARLERD-VQEVCL-DESFVPPCITLSASRWLRHVFSDISDQVASRCRRLEq------yKNPAGLGSGDLDFT-- 240 Desulf...
WP_014450442          171 YNLVPVAQVLWE-GGVIKP-SPSFIPPSLSLSTSRNLSSLVQEIRNECASRSRQLEe------fKTPREQKTEGMDAG-- 240 Leptos...
Q3A0R3                159 FLSIKIAEVLHDGDQRYRVvDS-YIPPVCRISGSPALAQRLERIVETLNAKRKLIEk------aREGCDDGTAGFARS-- 229 Peloba...
jgi:Marme_3676        163 VISLNIARLKKDMGGSYTL-DSDYIPPLVSVHAASGLMNSLRSLTELLTVRFKEINa-------RRTNVSDVGSYTPS-- 232 Marino...
jgi:Hhal_0165         162 RVGLPVARVVPGDAGGFRL-DPAFLPVACRLDASTGWQTLLGRITARVENRCARLRe-------EQGATGRVSAFEPG-- 231 Halorh...
WP_025280153          163 LIRLPVTRLTPRMGGGFQI-DDDFVPPLLSIEASPALQRFTGQLAERIRLQSRELA--------------------GEct 221 Ectoth...
PRJNA194094:J421_5497 241 gnEIATRWLLHA----VRSAEAPLRHLLATRRAHPEQLWFELSRLAGALCTFSLT-------TE-PRD-LPLYTHDDLGA 307 Gemmat...
WP_011768449          234 --NLSVGLAMMS----ISNHIATFIQFEENPSTQVSDIYLAYRQLISQLSMFSTEvsvigetLTeENS-IIPFNQNNLSD 306 Psychr...
WP_013261291          243 --ALNNHLALQT----LARYIPLLVHLVEGERIHPFDVYGVLRQLAGELSVFSNKmdvgieaGDtDLS-LPPYDHQRLGH 315 gamma ...
WP_014260279          243 --YFVFLLALRS----LNRYLPQLCHLLEAPHIHPWDVYGVLRQLAGEMSTFSEDlnalgerRDsTLA-VPQYDHGDLWR 315 Desulf...
jgi:Desal_0433        241 --STVFLLVLRT----LNRYAPQLDHFAAAPHIHPWHAYGLLRQIIGELSSFSREmsalgegPDgKKV-LPDYDHENIGP 313 Desulf...
WP_014450442          241 --YMIYILALRT----LNRYVPLLYHYAESDPVHPWLLYGTLRQMVGEVSTFSDRvnflgetDQsGEP-LPPYDHEDIWG 313 Leptos...
Q3A0R3                230 --DPNNHALLQN----LNSRLPRLKHLLNNLDLHPEQLYRQLCQVAGSFCTYHNT--------AtIDS-IPLYQHEDLTQ 294 Peloba...
jgi:Marme_3676        233 --EMADFLFVSD----ISDILSELRIVEQNPSASSLQLYSTLCRAHDKLALHTQP-------DKvPYT-QP-YQHDNLST 297 Marino...
jgi:Hhal_0165         232 --EVARLLLRQS----LEPAACALRSLVANPASHPGQLYDILARLVAALSALSEV--------TsPAEtVPVYDHDRPAA 297 Halorh...
WP_025280153          222 vcKPADRHLVHAmsgcLQRFLIRLEHLRAMESSHPEGLHLALAETCAEIQSLVPQ-------DDeDRT-LPLYRHEDPAS 293 Ectoth...
PRJNA194094:J421_5497 308 CFGALERHLREHLDVVVAARAVVVPLTRRTDVLYVGTISDPRCYePGARWFLGVR-SSVGAAETIARVPQLTKVCASKFV 386 Gemmat...
WP_011768449          307 CFSKVNNLTTKLLNELTVQPELLVNLIYQGDSKFVAQLSREFLD-PGYRIYLRIR-TKENVIDHLDNILNFLKVGADGQV 384 Psychr...
WP_013261291          316 CFYRALDIIGQVLGELTIGPELLVSLKREESGKFAGVLTREFFE-RKHSVYLLLR-TRENFSDLAANFLNHAKLGATGQV 393 gamma ...
WP_014260279          316 CFSELSVLVEQLFSSISVGPEHTVRLE-PEGSYLSASFEPRHFQ-ESNSYWLVLH-TSTSPEEVLESVRNMAKLSAAAKI 392 Desulf...
jgi:Desal_0433        314 CFEKAREIITNILDSLTAGPEFMSQFV-FSDPYFTVELPERAFV-AGNSFWLLIK-TE-NPEQALPELMNIAKLSATHGM 389 Desulf...
WP_014450442          314 CLTKAQTVLFTLLNNLTVGPDLIIRLE-KSDESFNGTLSQSFFS-PRTRYYLVVK-TEGDPERESSSFMDNAKIGPPSII 390 Leptos...
Q3A0R3                295 VFSRLEKLLSLLLELNKTVKNTALVLSKETDHLLSCKDIPTTLF-GKETFFIEAL-FDAEDPNWIVDFARQVKVTARDSI 372 Peloba...
jgi:Marme_3676        298 TFSELYGAIRDIFGLSNVRMEASIQFNMKAPGLYESSVINSASL-ENCDFYLAVY-LERSDSSWVDQLPSLVKLSSPSDI 375 Marino...
jgi:Hhal_0165         298 VFTALEEGLERLLDQAMPRQTRGVRLVCESEAVLVTEGAEQPLM-EGWTFFLAVHgAADPAGDWIARLPMDLRVGPREAL 376 Halorh...
WP_025280153          294 GLRMLQAHLWELLDRFRALHTRPPVLEPLSEGRFQARDLTRSLS-SSQLLYITVR-TEREDTDWIRDFPRQAKVASADQL 371 Ectoth...
PRJNA194094:J421_5497 387 LELVRRAFPGLTVDHVPAPPPGLAPRGELAYFEITLGGPCAQGLRDSHEMGVYVPAGLPDAVLEVA 452 Gemmatirosa kalamazo...
WP_011768449          385 DVYLKRALPGVQLSYLDKKPQGVATVPNSYYFGLDRQSFQWQKVIELSRIGVIWSDYIEDVALDLI 450 Psychromonas ingrahamii
WP_013261291          394 DVYARRSLPGVHLMHLQGKPIGVTGQANTQYFMIEKEGHEWGYIQDGGQIGLIWNNAPPDLAVDIV 459 gamma proteobacteriu...
WP_014260279          393 TTLVAMAVPGVPLHYFPVPPPGLPRRAKSFYFRIDHESPQWGEVQRTRRVSLYWDSKPEDLAGEIV 458 Desulfocurvibacter a...
jgi:Desal_0433        390 SNLLARAVQGIGMVHMENLPPGLPRSKDALCFRIDTESPHWEDVVRSGSLSLYWDSAPSDLAVYIA 455 Desulfovibrio salexi...
WP_014450442          391 SSLIRRALPGVELTAMSGPPQGLPRRLNAQYFRIEPHDPVWDAIRQEEAIQVHWPGAPEGSMIDLI 456 Leptospirillum ferro...
Q3A0R3                373 ETCVASALPGVRLVHTQRPPAKLATRSGCEYFRLEPRGDFWNQMIDEGSMAIYLPCPFNASDIKIV 438 Pelobacter carbinoli...
jgi:Marme_3676        376 QNLVASGMSGLPLQHIQRVPSKIRIKSGYEYFLIDKRSALWERVQSTKKISGILFGEFADADVELI 441 Marinomonas mediterr...
jgi:Hhal_0165         377 ERLVAAGVAGVRLVHAPRPPGQLPVKSGYEYFRLEPAGEHWEQAQRAGGLAVYRPAELAHLRMEMV 442 Halorhodospira halop...
WP_025280153          372 DLLIRTALPGVSLCHLPRPPADLPVPRGRECFRLEPQGESWQALLESDSLGIFLPAGLRHLQLELM 437 Ectothiorhodospira h...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap