Conserved Protein Domain Family
Phage_GPO

?
pfam05929: Phage_GPO 
Phage capsid scaffolding protein (GPO) serine peptidase
This family consists of several bacteriophage capsid scaffolding proteins (GPO) and some related bacterial sequences. GPO is thought to function in both the assembly of proheads and the cleavage of GPN. The family is found to function as a serine peptidase, with a conserved Asp, His and Ser catalytic triad, as in subtilisin, and as represented in MEROPS:S73. The family includes capsid assembly scaffolding protein from Enterobacteria phage P2 which cleaves itself and then becomes the scaffold protein upon which the bacteriophage prohead is built - a mechanism quite common amongst phages.
Statistics
?
PSSM-Id: 399136
Aligned: 25 rows
Threshold Bit Score: 319.245
Threshold Setting Gi: 490357495
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P25478          6 SKFFRIGVEGDTCDGRVISAQDIQEMAETFDPR-VYGCRINLEHLR-GILP--DGIFKRYGDVAE-LKAEKIDdds--al 78  Escherichia vi...
hku:LHK_02583   5 SKAFRVATEGATTDGREIRREWIEQMARNYDPA-VFGARVNIDHIK-GILP--DSPFKRYGDVTA-LEAREVE------- 72  Laribacter hon...
Q1QXQ5          1 mKWFRIATEGATTDGRNISAAWLQQMADNFDPD-TYGCRINLEHMR-GMLP--DGPFKSYGDVTA-LKTEKGE------- 68  Chromohalobact...
WP_012621778    5 SNWFVVATEGATVDGRQIERQWLSDIAETYDPK-TYGARINLEHFHmSWFDpeLAHSKCYGDVLA-VKAEEND------- 75  Glaesserella p...
Q19UY3          5 SKWFVVATEGATTDGREISREWLTQIEENYDPKnNYGARINLEHFRwRWFEkdDPHSYSYGDVLA-VKTEERE------- 76  Mannheimia vir...
Q8P6J6         10 SNWFRVAVEGATTDGRTIQRSWIDDMAATYNRE-TYGARIWIEHMR-SLLP--DSPFRAYGDVTA-VKAEEVEid----g 80  Xanthomonas ca...
WP_024911027    5 TKMFCLAVEGDTTDGRAITKRDLLDIASSYNPA-LYGARVDLEHIK-AYSP--ESVFRAYGDVQApLKTETLAdg---pl 77  Chania multitu...
WP_013200143    4 SKYFRVVVEGATCDGRDVTRQQIQEMAESYSPQ-LYGARCNLEHLK-SLSP--DSTFRMYGDVEA-AKAEEIAdg---pl 75  Erwinia billin...
KFD04539        4 SKPFRVAVEGATCDGRTLERQHIVQMAQRFNPT-VYGARVNLEHLR-GYSP--NSDFRAYGDVIS-VKAEEITee---pl 75  Rahnella aquat...
CCA91327        4 SKFFRVAVEGATVDGRVIQREWLEQMAASYDPA-TYTARINCEHVA-GYSP--DRPFNAYGSVLS-LKTEEVElsfngek 78  Novosphingobiu...
P25478         79 KGKWALFAKITPTDDLIAMNKAAQKVYTSMEIQPNFANTGKCYLVGLAVTDDPASLGTEYLEFCRTA-KHNPLNRFKLSP 157 Escherichia vi...
hku:LHK_02583  73 DGKLALFATIDPTDELVALTRARQKIYTSIEVVEQFADSGEAYLVGLAVTDDPASLGTEMLQFCARA-GHNPLAGRKSQP 151 Laribacter hon...
Q1QXQ5         69 DGKLQLLAAIDPTDDLKALNDKRQKVYTSMEVDPNFADTGEAYLVGLAVTDSPASLGTQMLQFAAGAgSESPLAGRKQRP 148 Chromohalobact...
WP_012621778   76 EGKLQLYAQIEPTDELVELVNSKQKVYTSIEVRTNFAKTGKAYLTGLAVTDTPASLGTQYLSFTTKN--------GEQQG 147 Glaesserella p...
Q19UY3         77 DGKLQLLAEIAPTEALVKLVKDKQKVYTSVEIDLNFADTGEAYLVGLAVTDTPASLGTEYLTFCAGA-THNPLADRKQKP 155 Mannheimia vir...
Q8P6J6         81 TKRLALFAQIEPTADLITINKSKQKLYTSIEVQEKFANTGKAYLVGLAVTDSPASLGTSMLSFASQNpDANPLADRKQSP 160 Xanthomonas ca...
WP_024911027   78 KGKLALYGQIDATDDLVALNKKRQKVYPSIQFHPQFPQTGGAYLMGLALTDTPASLGTEMLEFCSRA-AINPLASRKHSP 156 Chania multitu...
WP_013200143   76 KGKLALYALIDATDEMVELNKKRQKVYSSVEINPSFADTGKAYLMGLAFTDSPASLGTEMLQFCANS-PVNPLATRKSNP 154 Erwinia billin...
KFD04539       76 KGKMGLYVQVDATDDLVALKKSRQKIYHSIEVHPSFADTGEAYLMGLACTDSPASLGTEMMEFCAKN-SVNPLSSRKHDQ 154 Rahnella aquat...
CCA91327       79 KSLLALYAEIDANDQLVEINKAGQKLFTSCEIHPDFAGEGKAYLVGLAVTDQPASLGTEPLKFAALS------------R 146 Novosphingobiu...
P25478        158 ENLISVATPV---ELEFEDLPETVF---TALTEKVKSIFGRKQASD-------D------------------ARLN---- 202 Escherichia vi...
hku:LHK_02583 152 GSLFTAAVPV---ELEFVEATGPADa-gKGLFATVMALLTGKGKTD-------D------------------ARFA---- 198 Laribacter hon...
Q1QXQ5        149 DNLFTAAIET---EFDFTAEPPTDSg--PSLTERVKALFRKHDAKS-------E------------------AGFAafre 198 Chromohalobact...
WP_012621778  148 EIFTTEAVEC---SLTFAEEP-------VSFFEKMKAMFSKEKADTaqhkadvE------------------ARFA---- 195 Glaesserella p...
Q19UY3        156 ENLVSEAVEA---NLEFTAEPEKGA-----WLEKFKAMFTKAKTDN-------D------------------GKFA---- 198 Mannheimia vir...
Q8P6J6        161 GNLFTVAEET---ALEFSEVSEGPV---ANLLSRIRTALKSEDATSit-----------------------aEQFA---- 207 Xanthomonas ca...
WP_024911027  157 ECLIAAVDEAmgfSIELEETEAPPAdtgMQFFNRIKGILTGNQQKT-------A------------------GDIG---- 207 Chania multitu...
WP_013200143  155 ACLFSEAMET---VIEFEADAPAAEa-gNKFFSTIKTLLTKGQRQF-------S------------------AEAS---- 201 Erwinia billin...
KFD04539      155 ACFFTAAVES---TMEFEDEQPPQDe-gKNFFARIKALLGGTQQQF-------S------------------QQNG---- 201 Rahnella aquat...
CCA91327      147 PNLFTTAHET---ALELAAQPLSGEqigESIGRSLLAFFRKDRKEE-------EpatpppapapandnafdvDRFA---- 212 Novosphingobiu...
P25478        203 DVHEAVTAVAEHVQEKLSATEQRLa-----EMETAFSALKQEVTDRADetsqAFTRLKNS---LDHTESlTQQRRSKATG 274 Escherichia vi...
hku:LHK_02583 199 DHAAAIEALAESQQAVPTLQGAVR------ALQHSGQSLDARLQSLTA----ELADLKTR---LDSQPQ-PGFTRQPATG 264 Laribacter hon...
Q1QXQ5        199 ELEQTLGLFVEKHQALADDLNAR-------PSATDFNDLKAAHDTLQT----RFDELFQR---LDNTPR--HTPRQRATG 262 Chromohalobact...
WP_012621778  196 EHEQAQLLLAEKFTELEDKLK---------QTEAEKMALCADFEKLSA----DLTALQSRvdvIGSEPEhGYTPRPEITG 262 Glaesserella p...
Q19UY3        199 EHEKAMELLAEQFSKVSTEND---------RLQTELSTLQIEFTELQK----QAGEFAEKfakLEQEPSaNYTPRPKATG 265 Mannheimia vir...
Q8P6J6        208 ELGEGVEEIAEHVRGQDERFN---------RLQAEHAEQKTKHEQLAN----DLAQLRES---LSQQPDpAQPARPVVTG 271 Xanthomonas ca...
WP_024911027  208 QIQQAVEQIALSQKELLDGQTKLS------AIETENAALKQSVAKLTA----DLSTLTES---LSSQPE-PGKKRQPATG 273 Chania multitu...
WP_013200143  202 EIRDAVELVAKSQADTLDKIESFSqqqrkfADSTELSKVRD-----------DLAALTAK---LEKQDG-NFNQRPTAPG 266 Erwinia billin...
KFD04539      202 ENREAIEAIAESQGKLLDSTTQLSaavkgkADATELESLRK-----------DFKALEEK---LKGQDAeQYNQRPAATG 267 Rahnella aquat...
CCA91327      213 SVMGL--QIAAAVKPANDAVAALGa---------------------------RFDALESK---LKATEQpGSFTRAPATG 260 Novosphingobiu...
P25478        275 g--GGDALMTNC 284 Escherichia virus P2
hku:LHK_02583 265 ---GAGKTETDC 273 Laribacter hongkongensis HLHK9
Q1QXQ5        263 ---DDGAIVTDC 271 Chromohalobacter salexigens DSM 3043
WP_012621778  263 ----------GE 264 Glaesserella parasuis
Q19UY3        266 a--KAGDVQTDf 275 Mannheimia virus PHL101
Q8P6J6        272 ---GGVAVLTDC 280 Xanthomonas campestris pv. campestris
WP_024911027  274 ---------SNT 276 Chania multitudinisentens
WP_013200143  267 gngIDHANLADC 278 Erwinia billingiae
KFD04539      268 gdgQSTQHLADC 279 Rahnella aquatilis CIP 78.65 = ATCC 33071
CCA91327      261 ---GTGSIKTDC 269 Novosphingobium sp. PP1Y
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap