Conserved Protein Domain Family
Zea_mays_MuDR

?
pfam05928: Zea_mays_MuDR 
Zea mays MURB-like protein (MuDR)
This family consists of several Zea mays specific MURB-like proteins. The transposition of Mu elements underlying Mutator activity in maize requires a transcriptionally active MuDR element. Despite variation in MuDR copy number and RNA levels in Mutator lines, transposition events are consistently late in plant development, and Mu excision frequencies are similar.
Statistics
?
PSSM-Id: 114639
View PSSM: pfam05928
Aligned: 4 rows
Threshold Bit Score: 369.449
Threshold Setting Gi: 75319677
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q94KM1   1 MDFPPSKVVADAVEAARAAAVAASEARCAVFVAEKEAKAAVQFAAIVVDKVEAVKASSNVDLVDFKYHVNIKNSLRYAIQ 80  Zea mays
Q94KM3   1 MDFPPSKVVADAVEAARAAVVAASEARCAVFVAEKEAKAAVQFAAIAVDKVEAVKASSNVDLADFKYHVNIKNSLRYAIQ 80  Zea mays
Q42511   1 MDCPPSKVVADAVEAARAAAVAASEARCAVFVAEKEAKAAVQFAAIAVEKVEAVKASSNVDLVDFKYHVSIKNSLRYAIQ 80  Zea mays
P93803   1 MDCPPSKVVADAVEAARAAAVAASEARCAVFVAEKEAKAPVQFAAIAVDKVEAVKASSNVDLVDFKYHVNIKNSLRYAIQ 80  Zea mays
Q94KM1  81 EMRRQYKLLHSVQKLCSTIPEVQGGKIGKVRGHLEHVCKELDKTSIVCEEDLETKNPTWDLYDNPSVDDEHPLDDDELGD 160 Zea mays
Q94KM3  81 EMRRQSKLLHSVQILCSTIPEVQGGKIGKVRGHLEHVCKELDKTSIVCEEDLETKNPTWDLYDNPSVDDEHPLDDDELGD 160 Zea mays
Q42511  81 EMRRQSKLLHSVQKLCSTIPEVQGGKIGKVRGFLEHVCKELDKTSSICEEDLETKNPTWDLYDNPSVDDEHPLDDDELGD 160 Zea mays
P93803  81 EMRRHTKLLHSVQKLCSTIPEVQGGKIGKVLGHLEHVCKELDKTSIVCEEDLETKNPTWDLYDNPSVDDEHPLDDDELGD 160 Zea mays
Q94KM1 161 GYSTEDPELWEMAFEDFKWEEIKANVSFEEHNRLINYRFEEINDRNM 207 Zea mays
Q94KM3 161 GYSTEDPELWEMVFDDFKWEEIKANVSFEEHYRVINYRFEEINDRNM 207 Zea mays
Q42511 161 GYSTEDPELWEMVFDDFKWEEIKANVSFEEHYRVINYRFEEINDRNM 207 Zea mays
P93803 161 GYSTEDPELWEMVFEDFKWEEIKANVSFEEHYRVINYRFEEINDRNM 207 Zea mays
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap