5VLA


Conserved Protein Domain Family
Inhibitor_I9

?
pfam05922: Inhibitor_I9 
Click on image for an interactive view with Cn3D
Peptidase inhibitor I9
This family includes the proteinase B inhibitor from Saccharomyces cerevisiae and the activation peptides from peptidases of the subtilisin family. The subtilisin propeptides are known to function as molecular chaperones, assisting in the folding of the mature peptidase, but have also been shown to act as 'temporary inhibitors'.
Statistics
?
PSSM-Id: 399132
Aligned: 74 rows
Threshold Bit Score: 42.6851
Threshold Setting Gi: 75174412
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5VLA_A              77 TYVVVLKEETHLSQ-----SERTARRLQA-------------Q-----------AARrg-------yLTKILHVFHG--- 117 human
EHA28384            36 KYIVTFKSGIDNAK------IESHAAWVTel---------hrR-----------SLEgrstt-eddlPAGIERTYRIa-- 86  Aspergill...
WGS:ADNJ:MAA_10260  44 SYIIKFKDHVNEAA------VNDHHSWIQsi---------hkDgeeqrlelrkrSLGssp----veaFAGLKHTYNIa-n 103 Metarhizi...
XP_001391470        43 SYIVVFKKHVTSEL------ASAHHSWVQdi---------hdSqse-----rteLKKrslfglgdevYLGLKNTFDIa-g 101 Aspergill...
CAP96594            43 SYIVVFKKHVDPSS------ASAHQSWLQev---------htAhtg-----rmeLKKrslfgfdfeaFMGLKHTFHIa-g 101 Penicilli...
P58371              43 AYIIKFKKHVDHKS------AADHQMWIQkvhgerederlelRkrgl----fdsVnd---------aFTGLKHTYNVg-s 102 Pyricular...
XP_001905001        43 aYIVKFKKHVTEEK------VSDHHTWIQel---------htTrene---ridlKKRgqfpl-vddvFHGLKHTYKVg-s 102 Podospora...
P25036              70 RYVIVFNEDISLQQ------IQSHMQVVQkdhstsvgk-------ltendafwrVISssvs--sksqFGGIDNFFDIn-g 133 Saccharom...
P09232             182 RYIIVFKRGAPQEEidfhkENVQQAQLQSvenlsa-------------edaffiSTKdtsl--stseAGGIQDSFNId-n 245 Saccharom...
P40903              85 HYIIVLQPDLSEQE------FQAHTNWVSemhqmd--------------iasqeDEYydts--dsnyMFGLKHVYDFged 142 Schizosac...
5VLA_A             118 LLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ 152 human
EHA28384            87 NFAGYAGSFDEKTIEEIRKHNHVAYVEQDQVWYLd 121 Aspergillus niger ATCC 1015
WGS:ADNJ:MAA_10260 104 GFKGYSGHFHESVIEKVRNHGDVEFIEKDTIARIl 138 Metarhizium robertsii ARSEF 23
XP_001391470       102 SLIGYSGHFHEDVIEQVRRHPDVDYIERDSEVHTM 136 Aspergillus niger CBS 513.88
CAP96594           102 SLLGYAGHFHEDVIEQIRRHPDVDYIEKDSEVRTM 136 Penicillium rubens Wisconsin 54-1255
P58371             103 GFLGYAGHFDEETIEKVRRHPDVEAIERDTIVHTM 137 Pyricularia oryzae 70-15
XP_001905001       103 EFLGYAGHFDEETIEKVRRHPDVEYIERDSIVHTM 137 Podospora anserina S mat+
P25036             134 LFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKIS 168 Saccharomyces cerevisiae S288C
P09232             246 LFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEAT 280 Saccharomyces cerevisiae S288C
P40903             143 SFKGYSGQFSSNIVEQIRLHPHVIAVERDQVVSIK 177 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap