1X2N


Conserved Protein Domain Family
Homeobox_KN

?
pfam05920: Homeobox_KN 
Click on image for an interactive view with Cn3D
Homeobox KN domain
This is a homeobox transcription factor KN domain conserved from fungi to human and plants. They were first identified as TALE homeobox genes in eukaryotes, (including KNOX and MEIS genes). They have been recently classified.
Statistics
?
PSSM-Id: 399131
Aligned: 61 rows
Threshold Bit Score: 53.6924
Threshold Setting Gi: 156220663
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1X2N_A         25 WLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRR 64   human
EED90990       52 WFYEHRNNPFPTPDEKDEIIAATGLSERQVKDWMAGARRR 91   Thalassiosira pseudonana CCMP1335
EAY00934      140 WFENNIKNPYPSKEELAQLTKETGLSLKQLHTYFINKRVR 179  Trichomonas vaginalis G3
EAY13539      119 WIYQNWMNPYPSKDMKERIADKYGVSQKQLSTYLVNARMR 158  Trichomonas vaginalis G3
XP_002373266  256 WFLQNQECPYPSEEQKSQLARQTGFSMKRISTWFANARRR 295  Aspergillus flavus NRRL3357
Q0CM81        911 WLAQNQEYPYPSEEDKTRLAQETGFSRKRIATWFANARRR 950  Aspergillus terreus NIH2624
XP_001273098  243 WFSDNQEFPYPSEDEKVRLIRETGFSRRRLSTWFANARRR 282  Aspergillus clavatus NRRL 1
XP_660295     995 WFYQNEHCPYPSEEEKARLAAETGFSRQRISTWFANARRR 1034 Aspergillus nidulans FGSC A4
CAP97951      207 WFYQNQDYPYPTDAQKNQMAHETGFSQKRISTWFANARRR 246  Penicillium rubens Wisconsin 54-1255
XP_001932504  367 WFQQNRQSPYPTEDQKMELCNRTGLSLNQVSNWFINARRR 406  Pyrenophora tritici-repentis Pt-1C-BFP
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap