2P0O


Conserved Protein Domain Family
DUF871

?
pfam05913: DUF871 
Click on image for an interactive view with Cn3D
Bacterial protein of unknown function (DUF871)
This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
Statistics
?
PSSM-Id: 399126
Aligned: 91 rows
Threshold Bit Score: 84.5201
Threshold Setting Gi: 81667392
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P0O_A                243 FLLEVAP---SESRYLKRILGTHTNRLDAARDVLRSELSRTSexfrkdeiATIESEQ-TEARPVGTVTIDNEKYGRYXGE 318 Entero...
Q74HC9                239 ILLHTKKcenGDKDLYDYVLGKHNQRPDPAEYVVRCEDSRLHp------vPVIKKNN-TGKRYIGDITINNDKYQRYMGE 311 Lactob...
Prjna32935:ECBG_01511 239 IVLRVKD---LGSTYFEHVLGNHQNRYDEARDVLRSADARFNa------iPEVKPEL-SQERPVGAVTIDNQEYLRYMGE 308 Entero...
WP_021150573          240 VLLRTKD---IGSAYYQHILGEHESRQDEARDVIRSANARFAe------vPLISPET-AQKRVVGAVTIDNQDYLRYMGE 309 Entero...
WP_010719888          239 ILLHAEV---IDAQFYEYILGNHMNRQDEARDVIRSADARFRn------iPQIPPRD-TKERAKGTITLDNERYLRYMGE 308 Entero...
WP_023520119          239 ILLHVTL---LDPTFGPIILGTHTNRQDEAKAVVRSADARFRe------iPPIPARL-TDERKTGTVTLDNEAYLRYMGE 308 Entero...
WP_013773257          238 ICLTAEI----YDSNMAFVLGEHTNRQDEARDVIRSLESRFNk------tADIMPALpAKNRKIGTITIDNINYLRYQGE 307 Meliss...
BAK95771              244 MLLEIDL---LTKNYHSLFLGEHTNRIDEAEYVVRSQEARKNn------qEIIETEN-IQSREKGSITVDNKKYLRYMGE 313 Tetrag...
WP_014024448          239 IVLHVEN---NASAYFTSVLGEHDNRNDQSPGLIRSANARFKk------vEQIHKEH-TEKRNKGAVTLDNELYGRYMGE 308 Lactoc...
ELB70976               59 VLLHTEP---VDEEFYEYILGKHTNRQDDARDVIRSVDARFRe------iPPIPARN-TATRMKGSITLDNEKYLRYMGE 128 Entero...
2P0O_A                319 IQVTLVDLPKDEKVNTITRIIDKDQTILPLIKAGNQFTLV 358 Enterococcus faecalis V583
Q74HC9                312 IQILKVNLPASEKVNIVGKIIEKDIPLINLIKPSQEFILL 351 Lactobacillus johnsonii
Prjna32935:ECBG_01511 309 IQVCKRLLPADPKVNLAAQVIPADLPLIQQIKAGMRFKLE 348 Enterococcus casseliflavus EC20
WP_021150573          310 IQICKRILPADDKVNVAAQVIEEDLPLLQQIKAGMRFKIE 349 Enterococcus
WP_010719888          309 IQITKKDLPADEKVNRVAQISEAELPLLEQIRAGVNFKII 348 Enterococcus hirae
WP_023520119          309 IQLMKEDLPADEKVNCVARVISADLPLIQQIHAGMIYKFK 348 Enterococcus
WP_013773257          308 IQIIKNQLPANEKVNIIGRVIEKDRDLLRHIKGGQKFRIE 347 Melissococcus plutonius
BAK95771              314 LQITKDDLPADEKVNVLAKVIEKDRNLIDYIDSGCRFELK 353 Tetragenococcus halophilus NBRC 12172
WP_014024448          309 TQVCKKALPAHPNINVVAYVIEKDRDLLDVIYSKQKFELK 348 Lactococcus garvieae
ELB70976              129 IQLTKYDLPADEKVNVVAKVIKEELPLINQIKAGMNYQFI 168 Enterococcus faecium EnGen0050
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap