Conserved Protein Domain Family
DUF865
?
pfam05906: DUF865 
Herpesvirus-7 repeat of unknown function (DUF865)
This family consists of a series of 12 repeats of 35 amino acids in length which are found exclusively in Herpesvirus-7. The function of this family is unknown.
Links
?
Statistics
?
PSSM-Id: 114618
Aligned: 2 rows
Threshold Bit Score: 57.513
Created: 22-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Download Cn3D
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
Q69517  36 MGSHPFRQERPQPHNPLTFKPVKTTGTAVVFSAGF 70  Human betaherpesvirus 7
Q69517 386 MGSHPFRQETPRPHNPLTFKPVKTTGTAVDFSAGF 420 Human betaherpesvirus 7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap