4P6V


Conserved Protein Domain Family
NQRA

?
pfam05896: NQRA 
Na(+)-translocating NADH-quinone reductase subunit A (NQRA)
This family consists of several bacterial Na(+)-translocating NADH-quinone reductase subunit A (NQRA) proteins. The Na(+)-translocating NADH: ubiquinone oxidoreductase (Na(+)-NQR) generates an electrochemical Na(+) potential driven by aerobic respiration.
Statistics
?
PSSM-Id: 399115
Aligned: 44 rows
Threshold Bit Score: 281.375
Threshold Setting Gi: 15214095
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4P6V_A                               4 MITIKKGLDLPIAGTPSQ-VISDGKAIKKVALLGEEYVGMR-PTMHVRVGDEVKKAQILFEDKKNPGVKFTSPVSGKVVE 81 
Q8A8K7                               4 VIKLRKGLDINLKGKAAE-TYTTVKEPGFYALVPDDFPGVT-PKVVVKEQEYVMAGGPLFIDKYHPEVKFVSPVSGVVTS 81  Bacteroides thetaiotaomicron...
WP_005843517                         4 VIKLHKGLNINLKGKPAQ-EFFDVKQPDIYAIVPDDFHGVT-PKVVVKEQEYVTAGGTLFVDKNHPEVKFVSPVSGVVTS 81  Bacteroides...
wustl:BD1099                         4 VIKIKKGLDINLKGKASD-VLLNGGKSESYAIVPDYYNGIL-PKVVAKVGEKVKAGSVLMIDKNRPEIKFVSPVSGEVTA 81  Parabacteroides distasonis ATCC 8503...
WP_005874971                         4 vIKTKKGLALNLKGKPLPeMLAEPAQSPTYAVVPDDFEGVI-PKVTARPGDKVRAGSALMHHKAYPEMKFTSPVSGEVIA 82  Porphyromonas gingivalis...
WGS:AAXU:1101174000278_ALPR1_04713   4 IVKLKKGFDIKLEGEAKK-ELADFTPAQTFAIKPTDFIGLQrPKVLVNVGDTVKAGTPVMFDKAMDQVIYAAPVSGEVVD 82  Algoriphagus machipongonensis...
WP_013188172                         4 DITIKKGLDIRLVGSADK-VLVDAPKSKTCTIQPADFHLTI-PKMVVKEGAKLRAGDELFYSKTQDSIKVVSPIAGTLKE 81  Croceibacter atlanticus...
WP_015482065                         4 DIRIKKGLDIKLVGIAEK-TTTNSSLSSVYAIKPEDFHGIT-PKLVAKEGAEVKAGDTLFYSKSDERILFPSPVSGKVTE 81  Polaribacter sp. MED152...
EAR00747                             4 DIRIRKGLNINLVGAAEQ-TTSKAVLSNVYAINLEDFHGIT-PKMLVKQGAEVKAGQPLFYNKNCEEMMFVSPVSGELVE 81  Maribacter sp. HTCC2170...
EAR14284                             4 DIRIKKGLNINLVGAAEP-STSKAVSSNVYAINLNDFHGLT-PKMLVKTGAEVKAGEALFYNKDIEEMLFCSPVSGELVE 81  Robiginitalea biformata HTCC2501...
4P6V_A                              82 INRGAKRVLQSVVIEVAgdDQVTFDKFEANQLASLNRDAIKTQLVESGLWTAFRTRPFSKVPAIDSTSEAIFVTAMDTNP 161
Q8A8K7                              82 VERGARRKVLNIVVEAA--AEQDYEEFGKKNVSSMDADAVKSALLEAGLFAFIKQRPYDIIADPTVTPKGIFVSAFDTNP 159 Bacteroides thetaiotaomicron...
WP_005843517                        82 VERGERRKVLSISIAAA--KEQDYEEFGKKDVSTLTGEQVKAALLEAGLFSFIIQRPYIVVADPNAKPKGIFVSAFDTNP 159 Bacteroides...
wustl:BD1099                        82 VNRGEKRKVLSIVVKPD--AQIEYEEFGKKNVASLQGAEVKEVLLNAGMWPFIKQRPYDIVAAPLDTPRDIFVSAFYSAP 159 Parabacteroides distasonis ATCC 8503...
WP_005874971                        83 VNRGAKRKVLSIEVKPD--GLNEYESFPVGDPSALSAEQIKELLLSSGMWGFIKQRPYDIVATPDIAPRDIYITANFTAP 160 Porphyromonas gingivalis...
WGS:AAXU:1101174000278_ALPR1_04713  83 VKRGEKRKLLEITILAD--QTISHEDLGKADPKSLDRDALVAKLAAGGVWPQLIQRPYGVVANPEDTPKAIFISGFDTNP 160 Algoriphagus machipongonensis...
WP_013188172                        82 ITRGAKRVITHIVIEAD--GSNESRDFGAVNVASADAEVLRARFLESGLWPFIKQRPYDVIANPTSEPKAIFISGYASAP 159 Croceibacter atlanticus...
WP_015482065                        82 VIRGARRRVMAVKIAAD--ATQVHTDFGVKDAAKMSAEEVKNHLFTSGCWPFIKQRPYDVVANPNQAPKAIFISAYASAP 159 Polaribacter sp. MED152...
EAR00747                            82 IVRGARRRIITLKILAD--KTQTDTDNGIFNIENASSKEVKAHLLKSGCWPFVKQRPYDIIANPDANPKAIFVSGYTTAP 159 Maribacter sp. HTCC2170...
EAR14284                            82 IERGARRRILTLRILAD--KEQKTLEHTPLNPEKADAEAIRNFLLQTGCWPFIRQRPYDRIADPEVVPKAIFISAYITAP 159 Robiginitalea biformata HTCC2501...
4P6V_A                             162 LAAEPTVVINEQSEAFVAGLDVLSALTTGKVYVCKK-GTSLPRS--QQPNVEEHVFDGPHPAGLAGTHMHFLYPVSADHV 238
Q8A8K7                             160 LAPDFEFALKGEEANFQTGLDALAKMAKTYLSISVKqKA---AAltQAKNVTITAFDGPNPAGNVGVQINHLDPVSKGET 236 Bacteroides thetaiotaomicron...
WP_005843517                       160 LAADFEFVLKGQEKDFQTGLDALAKMAKTYLNISVEqKS---PAltNAKNVTVTAFDGPNPAGNVGVQINHISPINKGET 236 Bacteroides...
wustl:BD1099                       160 LAPNFDFIVKGQEADFQTGLNALAKLTNGKVYVGVRsGSVVS----GMKGVEIVEVEGPHPAANVGVQINHIKPVNKGEV 235 Parabacteroides distasonis ATCC 8503...
WP_005874971                       161 LAPDFDFIVRGEERALQTAIDALAKLTTGKVYVGLKpGSSLG-----LHNAEIVEVHGPHPAGNVGVLINHTKPINRGET 235 Porphyromonas gingivalis...
WGS:AAXU:1101174000278_ALPR1_04713 161 LAADYGFMLEGEEKYFQAGIDALGKLTSGKVHLNLNgASAAPSVfaNVSNAEINKVSGPHPAGNVGVQIHHIDPINKGDL 240 Algoriphagus machipongonensis...
WP_013188172                       160 LVADLDYTLAKQEEKLQAAVTALSKMTKGQVHVTIGkDSVSPFE--NLKDITLHKITGPHPAGNVGTQISKIDPVNKGEV 237 Croceibacter atlanticus...
WP_015482065                       160 LAADLEYTLAGKEAELQAAITAVSKLTEGKVHLSVGaN--SMFA--NLSGVEIHKVSGPHPSGNVGTQIAMIDPINKGEV 235 Polaribacter sp. MED152...
EAR00747                           160 LAAYSDYVLQGKENELQAAITALGKMTPGKVHVSVAnSN-SPLA--GLKGIELHKVSGPHPAGLVGTQINKIAPINKGEV 236 Maribacter sp. HTCC2170...
EAR14284                           160 LAADINYSLKGREAELQAALTALSKLTPGKVRVGVGkGEDNIFN--GLKDIEIHRVSGPHPAGLVGTQINRIDPINKGER 237 Robiginitalea biformata HTCC2501...
4P6V_A                             239 AWSINYQDVIAVGQLFLTGEL 259
Q8A8K7                             237 VWTIDPQAVIFIGRLFNTGRV 257 Bacteroides thetaiotaomicron
WP_005843517                       237 VWTLRAEEVIFIGRLFNTGRV 257 Bacteroides
wustl:BD1099                       236 VWTVNPADVIVIGRLFNKGVA 256 Parabacteroides distasonis ATCC 8503
WP_005874971                       236 VWTLKATDLIVIGRFLLTGKa 256 Porphyromonas gingivalis
WGS:AAXU:1101174000278_ALPR1_04713 241 LWTISPYGVIQIGKLMVEGVY 261 Algoriphagus machipongonensis
WP_013188172                       238 VWTVNAQDLIVIGESLLTGHF 258 Croceibacter atlanticus
WP_015482065                       236 VWVVTPQDLVVIGELLLTGKL 256 Polaribacter sp. MED152
EAR00747                           237 VWTVSPQDLVIMGELLLTGKF 257 Maribacter sp. HTCC2170
EAR14284                           238 VWTLSPQDLVIIGEALLTGKY 258 Robiginitalea biformata HTCC2501
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap