2ILX


Conserved Protein Domain Family
CNPase

?
pfam05881: CNPase 
Click on image for an interactive view with Cn3D
2',3'-cyclic nucleotide 3'-phosphodiesterase (CNP or CNPase)
This family consists of the eukaryotic protein 2',3'-cyclic nucleotide 3'-phosphodiesterase (CNP). 2',3'-cyclic nucleotide 3'-phosphodiesterase (CNP) is one of the earliest myelin-related proteins expressed in differentiating oligodendrocytes and Schwann cells. CNP is abundant in the central nervous system and in oligodendrocytes. This protein is also found in mammalian photoreceptor cells, testis and lymphocytes. Although the biological function of CNP is unknown, it is thought to play a significant role in the formation of the myelin sheath, where it comprises 4% of total protein. CNP selectively cleaves 2',3'-cyclic nucleotides to produce 2'-nucleotides in vitro. Although physiologically relevant substrates with 2',3'-cyclic termini are still unknown, numerous cyclic phosphate containing RNAs occur transiently within eukaryotic cells. Other known protein families capable of hydrolysing 2',3'-cyclic nucleotides include tRNA ligases and plant cyclic phosphodiesterases. The catalytic domains from all these proteins contain two tetra-peptide motifs H-X-T/S-X, where X is usually a hydrophobic residue. Mutation of either histidine in CNP abolishes enzymatic activity. CNPases belong to the 2H phosphoesterase superfamily. They share a common active site, characterized by two conserved histidines, with the bacterial tRNA-ligating enzyme LigT, vertebrate myelin-associated 2',3' phosphodiesterases, plant Arabidopsis thaliana CPDases and several several bacteria and virus proteins.
Statistics
?
PSSM-Id: 399110
Aligned: 8 rows
Threshold Bit Score: 343.691
Threshold Setting Gi: 348509328
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ILX_A         6 LPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKEL-RHF-ISGDEPKEKLDLVSYFGKRPPGVLHCTTKFCDYGKAT 83  Norway rat
EHB02823     185 LPLYFGWFLTKKSSEALRKAGQVFLEELGSHKAFRKEL-RHF-LSGDEPREKIDLLTYFGRRPPGVLHCTTKFCNYGKAP 262 naked mole-rat
P06623       165 LPLYFGWFLTKKSSAALWKTGQTFLEELGNHKAFKKEL-RHF-VSGDEPREKIELVTYFGKRPPGVLHCTTKFCDYGKAA 242 cattle
XP_005796825 462 LPLYFGWFLFSSVQDKVGCTAMDFLKTLDTLEGFKKHI-TDF---TGQAEKEVDLEQYF--ETKGILHCTTKFCDYGKAD 535 southern platyfish
XP_003442201 402 LPLFFGWFLLTSIQDKIKCTSMDFLKTLDTLEAFKKHL-IDF---SGKAE-EVDLEQYF--QPTGILHCTTKFCNYGKAE 474 Nile tilapia
XP_008111471 184 LPLYYGWFLSKRSSENLRKTGQAFLDELANSKVFKKEAnKHFgQATEDPKVKIDLTGYFAKRPPSVLHCTTKFTDFGKAP 263 green anole
O57389       185 LPMYFGWFLSKRSSEILRKAGQVFLDELGSLKAFKKES-KYF--TSEDPKIKIDLTSYFVKRPPGVLHCTTKYTDFGKAA 261 chicken
XP_012403724 165 LPLYFGWFLSKKGSESLRKAGQAFLDELSSHKAFKKEM-KHF-VSGDEPKEKIALASYFVKKPPGVLHCTTKFCDYGKAD 242 Tasmanian devil
2ILX_A        84 GAEEYAQQDVVRRSYGKAFKLSISALFVTPKTAGAQVVLNEQELQLWPSDLDK------PSSSESLPPGSRAHVTLGCAA 157 Norway rat
EHB02823     263 GTEEYAQQDVVKKSYGKAFTLTISALFVTPETVGARVELGAQELQLWPADVDK------LSVSDNLPRGSRAHVTLGCAA 336 naked mole-rat
P06623       243 GAEEYAQQDVVKKSYCKAFTLTISALFVTPKTTGARVELSEQQLALWPNDVDK------LSPSDNLPRGSRAHITLGCAG 316 cattle
XP_005796825 536 GASEYAKNPVIKKSYSSVFELSLTALFVTPRTVGARVSLTDEQLKLWPADTEKese-adVPGSASLPVGSRAHVTLGCAK 614 southern platyfish
XP_003442201 475 GAKEYAEKQAVKDFYGSIFDLSLSALFVTPRTFGARVSLTEEQLQLWPADADAekqaesVPAAASMPLGSRAHVTLGCAE 554 Nile tilapia
XP_008111471 264 GADDYAQQEIVKSSYGKSFFLTTTALFITPRTVGARVELNEQQLALWPSDVDV------LPPAVSFPKGSRAHITLGCAS 337 green anole
O57389       262 GAEDYAQQEAVRASYGKGFTLSISGLFVTTKTVGARVELSEQQLLLWPGDADK------LQATDSLPKGSRAHITLGCAS 335 chicken
XP_012403724 243 GANEYAQQDVVKKSYSKAFTLNVSALFVTPKTMGARVELGEQELPLWPAEVDK------LTPTDNLPRGSRAHITLGCAV 316 Tasmanian devil
2ILX_A       158 DVQPVQTGLDLLEILQQVKGGSQGEEVGELPRGKLYSLGKGRWMLSLAKKMEVKAIFTGYYG 219 Norway rat
EHB02823     337 NVELMQTGLDLLEIVQQERGGSRGEEVGELSRGKLLSLGRGRWVLSLAKKVESKAVFTGYYG 398 naked mole-rat
P06623       317 DVEAVQTGIDLLEIVRQEKGGSRGEEVGELSRGKLYSLGSGRWMLSLAKKMEVRAIFTGYYG 378 cattle
XP_005796825 615 DVEPVQTGLDLLQILTL----PQGEVVEEMKLGSLQYYGEGRWMLSLREPICAATCFSSFYG 672 southern platyfish
XP_003442201 555 NVEPVQTGVDLLEILTLQQEGQQGEQVEEMELGTLTYYGTGKWLLNLREPISAPACFSSFYG 616 Nile tilapia
XP_008111471 338 GIEAVQTGLDLLEFAKLEKAGNKGEEVGEIGGGKLLSYGNGLWMLVFSKKIEVRAIFSGYYG 399 green anole
O57389       336 GVEAVQTGMDLLEFVKLEKAGSKGEEVGEIGGGKLQYFGNGMWMLTLSKKIDVRAIFSGYYG 397 chicken
XP_012403724 317 GIEPVQTGIDLLEMVRQEKGGSQGEEVGELSRGTLYSLGNGQWMLRLAKKLEFRAIFTGYYG 378 Tasmanian devil
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap