5CB2


Conserved Protein Domain Family
RHD3

?
pfam05879: RHD3 
Click on image for an interactive view with Cn3D
Root hair defective 3 GTP-binding protein (RHD3)
This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins. It has been speculated that the RHD3 protein is a member of a novel class of GTP-binding proteins that is widespread in eukaryotes and required for regulated cell enlargement. The family also contains the homologous yeast synthetic enhancement of YOP1 (SEY1) protein which is involved in membrane trafficking.
Statistics
?
PSSM-Id: 399109
Aligned: 8 rows
Threshold Bit Score: 929.922
Threshold Setting Gi: 68835144
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5CB2_A  64 FGSQSTGKSTLLNRLFNTNFDVMDE-LNRQQTTKGIWLAYSPVVsttlg--httsKSNILVMDVEGTDGRERGEDQD-FE 139 Candida albicans SC5314
Q9FKE9  46 MGPQSSGKSTLLNHLFKTSFREMDAfAGRSQTTKGIWMARCVGI-----------EPFTIAMDLEGTDGRERGEDDTtFE 114 thale cress
Q9SSN0  48 MGPQSSGKSTLLNHLFGTNFMEMDAfKGRSQTTKGIWLARCAGI-----------EPCTLVMDLEGTDGRERGEDDTaFE 116 thale cress
P93042  43 MGPQSSGKSTLLNHLFGTNFREMDAfRGRSQTTKGIWIARCAGI-----------EPCTVVMDLEGTDGRERGEDDTaFE 111 thale cress
Q8TGG5  58 FGSQSTGKSTLLNHLFGTHFSVMSD-SERRQTTKGIWMSKNKREgeatvdptlrmADNILVMDVEGTDGRERGEDQD-FE 135 Aspergillus fumigatus...
Q99287  43 FGSQSSGKSTLLNVLFNTNFDTMDAqVKRQQTTKGIWLAHTKQVnttie--idndRPDIFVLDVEGSDGSERGEDQD-FE 119 Saccharomyces cerevis...
Q9UTE0  45 LGSQSTGKSTLLNNLFGTSFSVMDA-SKRQQTTKGIWLSKANN-------------SPILVMDVEGTDGRERGEDQD-FE 109 Schizosaccharomyces p...
Q9P5X6  62 FGSQSTGKSTLLNHLFGTQFSVMSE-RERRQTTKGIWMSKNKNEgk--------mADNILVMDVEGTDGRERGEDQD-FE 131 Neurospora crassa OR74A
5CB2_A 140 RKAALFALSTSEVLIINIWETQVGLYQGANMGLLKTVFEVNLSLFgksklethNDHKVLLLIVIRDHVGvTPVESLAKTF 219 Candida albicans SC5314
Q9FKE9 115 KQSALFAIAVADIVLINMWCHDIGREQAANKPLLKTVFQVMLRLF--------SPRKTTLLFVIRDKTK-TPIELLERAL 185 thale cress
Q9SSN0 117 KQSALFALAISDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLF--------SPRKTTMLFVIRDKTR-TPLENLEPVL 187 thale cress
P93042 112 KQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLF--------SPRKTTLMFVIRDKTR-TPLENLEPVL 182 thale cress
Q8TGG5 136 RKSALFALATSEVLIVNIWEHQVGLYQGANMGLLKTVFEVNLQLFlkd---knTTHRSLLFFVIRDFVGtTPLKNLQKTL 212 Aspergillus fumigatus...
Q99287 120 RKAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTVFEVNLSLFgk----ndNDHKVLLLFVIRDHVGvTPLSSLSDSV 195 Saccharomyces cerevis...
Q9UTE0 110 RKSALFSISTSEVIIVNMWENQVGLYQGSNMALLKTVLEVNLQLFhn------kkERCLLQFVIRDFLGnTSMENLADTI 183 Schizosaccharomyces p...
Q9P5X6 132 RKSALFALATSEVLIVNIWEHQVGLYQGANMGLLKTVFEVNMQLFlkd---kqNQTRSLLFFVIRDHIGvTPLANLRNTL 208 Neurospora crassa OR74A
5CB2_A 220 TLDLQNMWSSLAKPAELEHLQFADFFDVTFHALNHKVLQPKEFGEGINRLGDRLVVS---------------NELFKPEY 284 Candida albicans SC5314
Q9FKE9 186 REDIQKIWDSVRKPEAHKNTPLNEFFNVMIVALSSYEEKEKQFEQEVAELRQRFFHSi-------------sPGGLAGDR 252 thale cress
Q9SSN0 188 REDIQKIWDSVPKPEAHKETPLSDFFNVEVVALSSYEEKEEQFKEQIASLRQRFMHSi-------------aPGGLAGDR 254 thale cress
P93042 183 REDIQKIWDSVPKPQAHKETPLSDFFNVEVVALSSYEEKEEQFKEQVYNLRQRFFQSv-------------aPGGLAGDR 249 thale cress
Q8TGG5 213 MEDMARLWESISKPPGLESSSVHDYFDFQFYGLPHKSYQPEQFVAETKKLSLRFREGqrdpsmdarrgefseGGVFLPEY 292 Aspergillus fumigatus...
Q99287 196 TRELEKIWTELSKPAGCEGSSLYDYFDLKFVGLAHKLLQEDKFTQDVKKLGDSFVMkg------------teNYYFKPQY 263 Saccharomyces cerevis...
Q9UTE0 184 MTDLNNIWASLSKPEGFENSVINDFFDVGFTGLPHKILCSDAFSEAVDSLRERFVDNnn------------sDYIFNVSY 251 Schizosaccharomyces p...
Q9P5X6 209 IQDLTHIWSSISKPAGLENSKIEDYFDFAFAALPHKILQPDKFISEVQNLGSRFIAGhrnkdsdatddqeltGGVFLPEY 288 Neurospora crassa OR74A
5CB2_A 285 HHDVPIDGWTMYAERCWEQIETNKDLDLPTQQILVAQFKCDEIVESVFQEFLTKyqh------hfKEVDAAPDFEELGAL 358 Candida albicans SC5314
Q9FKE9 253 RGVVPASGFSFSSQQIWKVIKENRDLDLPAHKVMVATVRCEEIANEKLRDLATNesw-----lelHEAAEGGLVPGFGKK 327 thale cress
Q9SSN0 255 RGVIPASGFAFSADQIWRVIKENKDLDLPAHKVMVATVRCEEIANEKFAHFITNedw-----rklDEEVQAGPVSNFGKR 329 thale cress
P93042 250 RGVVPANAFAFSAKQMWQVIKDNKDLDLPAHKVMVATVRCEEIANEKFSSFIANenw-----relEEAVQSGPVSGFGRK 324 thale cress
Q8TGG5 293 HRRIPADGFSRYAEGIWDQIVNNKDLDLPTQQELLAQFRCDEILREVMIAFDEAivpfeekqsqsARLGEPEVLGGLGAA 372 Aspergillus fumigatus...
Q99287 264 HHRLPLDGWTMYAENCWDQIERNKDLDLPTQQILVARFKTEEISNEALEEFISKyde--------siAPLKGNLGSLTSQ 335 Saccharomyces cerevis...
Q9UTE0 252 HKKIPADGFSLYTREIWDTIENNKDLDLPTQQQLLAQYRCDEIITEVMEPFSTActi------lqKEFLPGNLCKDLPTK 325 Schizosaccharomyces p...
Q9P5X6 289 HRRIPADGLSIYAEGIWDQIVSNKDLDLPTQQELLAQFRCDEIAREVQIAFDAAiapleeqqaesTRAGKPAVLPNLGQI 368 Neurospora crassa OR74A
5CB2_A 359 FADLRQDAFEDYDASASRYNKAVYEQKRKKLRWLINDKLKEVFDVHAKNLCNTLLEKFEKDLV-ALK-GK------DFAV 430 Candida albicans SC5314
Q9FKE9 328 LSSILEKYFSEYDAEAIYFDEGVRKEKRLQLKLNALDFVYPSYATMLGHLRSNALESFKIRLEqSLNqGE------GFAK 401 thale cress
Q9SSN0 330 LTTILGSCLSEYDGEATFFDEGVRSSKRQQLEEKLLQLVNPAFQDVLGHIRWGILEKFKASFDkALGiGE------GFSS 403 thale cress
P93042 325 LSSILQASLSEYDTEATYFEESVRSSKRQQLQEKLLQLVQPTFQDVLGHLRAGALENFKNAFEkALDaGE------GFSS 398 thale cress
Q8TGG5 373 MRSSRAKAVKNFETEASRYHKGVYQRKRAELESKVDTRLKALLQGQLNAAHKSGINEFSEAVSsSVKsGQkqgagyDFAE 452 Aspergillus fumigatus...
Q99287 336 LVKLKEECLTKYDEQASRYARNVYMEKREALNTKLNSHISGTINEFLESLMEKLWDDLKLEVSsRDKaTT------SFVE 409 Saccharomyces cerevis...
Q9UTE0 326 LLNMFETVIEAYDRQASRYNVHIYQKKKQELIASVDSHLYVFFQAQLNALHKELIKSFFDASN-EFPsDT------PFKE 398 Schizosaccharomyces p...
Q9P5X6 369 GAEAREKCVKNFETQASRYHKGVYTTKRAELEDKIDNRLKALYQAHLTAAHKAGVTAFSEAVAnAVKaGQkaggayEFAE 448 Neurospora crassa OR74A
5CB2_A 431 NVKTLSTKLVEDVNFQV-SLMSLQGDLSLd-EIILALTKDIDAIVAKQQVVELNSIVNKSVKKLSASLSKSIQFELGDPN 508 Candida albicans SC5314
Q9FKE9 402 AVRDSQQSCLMVFDKGCeDAAVKQATWDAs-KIREKLCRDIDAHTFFARSAKLSELTANYEKRLTQALSEPVESLFEAGG 480 thale cress
Q9SSN0 404 ASQDWFKACMTQFDEECaGAIIEQANWDTs-KVRDKLVRDIEAHISSVRTSKLSELTSLYESKVHEALSEPVEALLDGAN 482 thale cress
P93042 399 SAKSCAQSCISKFDKGCeEAVIEQAKWDTs-KTREKLERDIEAHISSVRTAKLAELTTLYESKLNVALSGPVEALLDGAN 477 thale cress
Q8TGG5 453 IVNEEVKKAIAKFEDVArSTVVEGTTWSDykQELALYEKELADVSGRLRREEMRRLANRVERWVQSRLGESVGLEFNALG 532 Aspergillus fumigatus...
Q99287 410 SVAAGKSKIEKEFNESMeTFKKLGLLISNe-EITCKFSDDIEERIKQLRDAELKAKIGRIKKNLVPELKDHVIHLLSHPS 488 Saccharomyces cerevis...
Q9UTE0 399 SSSIKINELVNKMREEGeSLSLPHVHWDVd-PFILKLSEELTQNSETLCKEKLKEKLEELFTGFEFEVSEAVEVAFQKLS 477 Schizosaccharomyces p...
Q9P5X6 449 IVEKQKTKTLEIFKKEAqSLAIPGVAWSNfkPQYLIFEKELDEVSARLRKEEMRRLAIRVERWVKSRLGDAIGLEFNKLG 528 Neurospora crassa OR74A
5CB2_A 509 ------------------EETWDNVLQQFKGVYE---------KFGGdfglGTSST-QNQQAIEKFKFKSWCQFYDVTHK 560 Candida albicans SC5314
Q9FKE9 481 ------------------KETWPSIRKLLKRETEtavtdfldvVTGF----ELDHA-KIDAMVQNLKNYSQSLVEKKARE 537 thale cress
Q9SSN0 483 ------------------DETWSTVKKLHRRETEsavsglssaLAGF----DMEEE-TRDRMVKSLQDYARGVIETKAKE 539 thale cress
P93042 478 ------------------DETWPAIRKLLRREGElavyglsnaLSGF----EMDEE-TRSKMLADLENYARGIVETKAKE 534 thale cress
Q8TGG5 533 sgragggap-etgekpleKAFWDRVWNVFVETVLdaerrftdrASSF----DASLE-EVDVGLWRLRRKSWGVLRAKIDE 606 Aspergillus fumigatus...
Q99287 489 ------------------KKVWDDIMNDFESTIKdnisayqveKDKYdfkiGLSES-ENAKIYKNIRILAWRTLDTTVHD 549 Saccharomyces cerevis...
Q9UTE0 478 ------------------HNVWDTLLNEFLAAQNttiekikniVPFYv---DIDDTkTTEEYIINFKKNSWLFFRKKIDS 536 Schizosaccharomyces p...
Q9P5X6 529 sgrggsgapesgekpateKDIWDRVWKAFISIVGeaesrftdrAKSF----EASDD-EVQVGLWRLRRKSWVALREKIEE 603 Neurospora crassa OR74A
5CB2_A 561 LIsrEKLLALLQDRFDDKFRYDENGLPKLYLNEQDLEKTFAVAKQHALQVLPILTFAKLADGSEIVPDYDIFDSKLREQF 640 Candida albicans SC5314
Q9FKE9 538 EA--AKILIRMKDRFSTVFSHDKDSMPRVWTGKEDIRAITKDARAEALSLLSVMTAIRLDERPDNIESTLFSSLMDGTVS 615 thale cress
Q9SSN0 540 EA--VRVLMRMKERFGTIFSHDSDSMPRVWTGKEDLRAITKSARSASLKLLSVMAVIRLGDEPDNIEKTLTVALLDPTKN 617 thale cress
P93042 535 EA--GRAMMRMKDRFATIFSHDSDSMPRVWTGKEDIRAITKMARSASLKLLSVMAVIRLDDELDNIEKTLTLALFNSTGN 612 thale cress
Q8TGG5 607 EMteGNLLLKLRENFEDKFRYDDAGVPRIWRPTDDIEGIYTRARESTLTLIPLLSRFRLAETSAPPPLDRWIGHTPSSAT 686 Aspergillus fumigatus...
Q99287 550 YLkiDTIVSILRDRFEDVFRYDAEGSPRLWKTEEEIDGAFRVAKEHALEVFEVLSLAVTSDNVEIIPDVPMAEEESGEDN 629 Saccharomyces cerevis...
Q9UTE0 537 EMseVLLQQRLRVYFEELFRYDSDGMPKLWKKSGTIDRDYRESLTKTLDLINVLASIKVSDGNYPDLNVDIKTLEPEYTS 616 Schizosaccharomyces p...
Q9P5X6 604 EVmeSNILMKLRENFEDKFRYDEDGVPRIWRPSDDIEGIYTRARESTLGLVPLLSRFRLTSTSAPPDLIEFVGPQPHGVE 683 Neurospora crassa OR74A
5CB2_A 641 LG------------GYDDSDDEEDHCFAEIITEQEKLEVLAKFKKEVDAKYIET----KRSIVQHITQ 692 Candida albicans SC5314
Q9FKE9 616 AAsshnrsvgtstdPLASSSWEEVPPNNILLTPVQCKSLWRQFKSETEYTVTQAisaqEAHKRNNNWL 683 thale cress
Q9SSN0 618 DTskksi---ttsdPLASSTWDEVPSSRTLITPVQCKSIWRQFKTETEYTVTQAisaqEANRRGNNWL 682 thale cress
P93042 613 NAtsksi---stidSLASSTWEKVAPEKTLITPVQCKSLWRQFKNETEYTVTQAisaqEANRRNNNWL 677 thale cress
Q8TGG5 687 PAdeedl---ppigGVDEEEGKSLDEEMMILSEAKRQELTVRFKKAADGVYVEA----KRSAIGGMTQ 747 Aspergillus fumigatus Af293
Q99287 630 EIyrdne------------gvfhsRRFAHILTELQKENVLDQFRRQINITVLDS----KRSIITTRTH 681 Saccharomyces cerevisiae S288C
Q9UTE0 617 PA-----------------------SFFTILNRRRVSDISVNFKRSADLIFMDC----KRSVINTTTR 657 Schizosaccharomyces pombe 972h-
Q9P5X6 684 PGdeedl---tpigGVDEDEGKSLEEETTILSEPKKQDLVVRFKKMADGVYVEA----KRSAIGGITQ 744 Neurospora crassa OR74A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap