Conserved Protein Domain Family
BIV_Env

?
pfam05858: BIV_Env 
Bovine immunodeficiency virus surface protein (SU)
The bovine lentivirus also known as the bovine immunodeficiency-like virus (BIV) has conserved and hypervariable regions in the surface envelope gene. This family corresponds to the SU surface protein.
Statistics
?
PSSM-Id: 147812
View PSSM: pfam05858
Aligned: 4 rows
Threshold Bit Score: 542.744
Threshold Setting Gi: 82294412
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65603   1 MDQDLDRVERGEGEGRSDELRLLIQEDLDTGRLTTKETLTAWS--NNGEIHPWVLTGMMSIGVGML--MGVYCNIPGPVT 76  Bovine immunodeficien...
Q65604   1 MDQDLDRVERGEGEGRSDELRLLIQEDLDKGRLTTTEALQAWI--NNGEIHPWVLAGMMSVGVGML--MGVYCSIPGTVI 76  Bovine immunodeficien...
P19557   1 MDQDLDGAERGERGGGSEE---LLQEEINEGRLTAREALQTWI--NNGEIHPWVLAGMLSMGVGML--LGVYCQLPDTLI 73  Bovine immunodeficien...
Q82857   1 MMEE-GRKEEPEERGEKSTMRDLLQRAVDKGHLTAREALDRWTleDHGEIHPWIILFCFAGAIGVIggWGLRGELNVCML 79  Jembrana disease virus
Q65603  77 WLLIFQLCIYLAFGETSRRLDVNSWNWVRGVLIIGILGTLTMAGTALADADPSdthsdpenitykvdvppSVPENITREV 156 Bovine immunodeficien...
Q65604  77 WLLILQLCIYLALGETSRRLNGDSWNWVRGVIIMGILGTLSMAGTTLAESSRGva--------------pSVPENITPKD 142 Bovine immunodeficien...
P19557  74 WILMFQLCLYWGLGETSRELDKDSWQWVRSVFIIAILGTLTMAGTALADDDQS-----------------TLIPNITKIP 136 Bovine immunodeficien...
Q82857  80 IVLVVLVPIYWGIGEAARNIDSLDWKWIRKVFIVIIF------------------------------------------- 116 Jembrana disease virus
Q65603 157 INgsvDTDpc-tgPChtnmqdTLIFLGLVCILGFLGVIIAMRRSNPGGILSARDAVDWWLSANKEIPLKFTVPIILISSP 235 Bovine immunodeficien...
Q65604 143 IKgseDTD-----PYhanmpyTLTILGLVCILGLLGVIIAMRRSNPEGILAARDAVDWWLSANKEIPLKFTVPIILISSP 217 Bovine immunodeficien...
P19557 137 TK---DTEpgctyPW------ILILLILAFILGILGIILVLRRSNSEDILAARDTIDWWLSANQEIPPKFAFPIILISSP 207 Bovine immunodeficien...
Q82857 117 -----------------------------VLVGLLG-------------------------------------------- 123 Jembrana disease virus
Q65603 236 LAGTMGWFVMKRYSKTLEGGCQFCGSLSLMWGMLLVEIGRRLTHREWSVSRIVVILFISFSWGMHISK--VEAK-EHLAM 312 Bovine immunodeficien...
Q65604 218 LAGIMGYFVMDKYSKILKGGCQFCGSISLMWGMLLIEIGRRLTHREWSVSRLVVILLISFSWGMYTSKvgVEATgRHLAM 297 Bovine immunodeficien...
P19557 208 LAGIIGYYVMERHLEIFKKGCQICGSLSSMWGMLLEEIGRWLARREWNVSRVMVILLISFSWGMYVNR--VNASgSHVAM 285 Bovine immunodeficien...
Q82857 124 -------------------GC--------------------------------------------------SAQrQHVAM 134 Jembrana disease virus
Q65603 313 VTSPPGYRIVNDTSKAPWFCFSNAPIPSCRSSQWGGKYFQEKVNGTVVKQLIKKAEGHTRARWIE-PDLFEEVIYELALL 391 Bovine immunodeficien...
Q65604 298 VTSPPGYRIVNDTSKAPWFGFSQAPIPSCRSSAWGGKYYQEKVNSTVVEQLFKRIEKHSRASWIE-PDLFEEVIYELALL 376 Bovine immunodeficien...
P19557 286 VTSPPGYRIVNDTSQAPWYCFSSAPIPTCSSSQWGDKYFEEKINETLVKQVYEQAAKHSRATWIE-PDLLEEAVYELALL 364 Bovine immunodeficien...
Q82857 135 LLSPPGIRL-PSTVDIPWFCISNAPIPDC--VHWTVQKPDQKHQQ--IENVMELQEVLDNATFFEvPDLFDRVYLELARL 209 Jembrana disease virus
Q65603 392 SANGS-----------YQVKVSNDTDICDTSNSSQDGDQTM---TRLDLRGNLSDTWVWNSSLQFGVHWHIVLVGFNSSE 457 Bovine immunodeficien...
Q65604 377 SANGS-----------YQVRASNNTDICDTSNSTQDGNQTM---TRLDLKENLSSTWIVNSSLQFGVHWPYVLIGYNNSN 442 Bovine immunodeficien...
P19557 365 SANDS-----------RQVVVENGTDVCSSQNSSTNKGHPM---TLLKLRGQVSETWIGNSSLQFCVQWPYVLVGLNNSD 430 Bovine immunodeficien...
Q82857 210 DANSTgvpvnipptgiSQVKGDCSTGDIQGMNETLSTRGTLgerTFLSIR---PGGWFTNTTVWFCVHWPFGFIQ----- 281 Jembrana disease virus
Q65603 458 -TPTDFNNDTWIATSCMDPIQLNKSS---------EEL-KNL-SRPISCVNS--TTTRVCRGNDTLCGYNMDCLNFGKRA 523 Bovine immunodeficien...
Q65604 443 iTSGNYNNDDWIATNCMDPIQLNQSE---------KDL-EKF-GRPISCVKK--NTTGWCVQASTLCGYNTNCLKFGERA 509 Bovine immunodeficien...
P19557 431 -SNISFNSGDWIATNCMHPITLNKSA---------QDLgKNF-PR-LTFLDG--QLSQL---KNTLCGHNTNCLKFGNKS 493 Bovine immunodeficien...
Q82857 282 -RKENLSEGSAQVRNCLDPINVTEPRvanysycplEYKgKNYiNKGLKCVGGrvDLSSNPEQHTDLLACGTFCQNFRNCD 360 Jembrana disease virus
Q65603 524 LSTNSLVLCQKNGTd-----DNNTFHSLSYSFSKQASYRWILVKVPSYGFVVVNDTGTS 577 Bovine immunodeficiency virus
Q65604 510 FSTNSLILCQRNETsqgnetSNKIFYSLSHSFSKQASHKWILVKVPSYGFVVVNDTYAP 568 Bovine immunodeficiency virus
P19557 494 FSTNSLILCQDNPI------GNDTFYSLSHSFSKQASARWILVKVPSYGFVVVNDTDTP 546 Bovine immunodeficiency virus R29
Q82857 361 MVSRDILIGYHPS-------QQKQHIYINHTFWEQANTQWILVQVPNYGFVPVPDTERP 412 Jembrana disease virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap