6URO


Conserved Protein Domain Family
Suf

?
pfam05843: Suf 
Suppressor of forked protein (Suf)
This family consists of several eukaryotic suppressor of forked (Suf) like proteins. The Drosophila melanogaster Suppressor of forked [Su(f)] protein shares homology with the yeast RNA14 protein and the 77-kDa subunit of human cleavage stimulation factor, which are proteins involved in mRNA 3' end formation. This suggests a role for Su(f) in mRNA 3' end formation in Drosophila. The su(f) gene produces three transcripts; two of them are polyadenylated at the end of the transcription unit, and one is a truncated transcript, polyadenylated in intron 4. It is thought that su(f) plays a role in the regulation of poly(A) site utilisation and an important role of the GU-rich sequence for this regulation to occur.
Statistics
?
PSSM-Id: 399092
Aligned: 21 rows
Threshold Bit Score: 261.15
Threshold Setting Gi: 218511812
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6URO_E       375 TLVYIQYMKFARRAEGIKSGRMIFKKAR-EDTRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDY 453 
Q4PCV8       623 ALVWIKYMHFLRRTEGIRPARSVFSRAR-KSPHCTWQVFEASALMEYHCSKDAVVATKVFELALKTFGSDEAFVVRYLDF 701  Ustilago maydi...
EDO40717     391 TLAFIQYMRFSRRAEGVKESRSVFKRAR-EDARTNFHVFVASALMEYYCGKDKAVAFKIFELGLKKYTNEADFVLPYVDY 469  starlet sea an...
XP_020797035 375 TLVYIQYMKFARRAEGIKSGRTIFKKAR-EDPRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYILAYIDY 453  great blue-spo...
Q0IFE2       375 TLAYIQYMKFARRAEGIISARAIFKKAR-EDVRSTYHVFVAAALMEYYCTKDKDIAFRIFELGLKRFGGSPEYVMCYIDY 453  yellow fever m...
P25991       408 TLVYVQYMKFARRAEGIKSARSIFKKAR-EDVRSRYHIFVAAALMEYYCSKDKEIAFRIFELGLKRFGGSPEYVMCYIDY 486  fruit fly
Q8GUP1       333 SLAHIQYLRFLRRAEGVEAARKYFLDAR-KSPSCTYHVYIAFATMAFCIDKEPKVAHNIFEEGLKLYMSEPVYILKYADF 411  thale cress
P25298       413 TFVFCVYMNTMKRISGLSAARTVFGKCRkLKRILTHDVYVENAYLEFQNQNDYKTAFKVLELGLKYFQNDGVYINKYLDF 492  Saccharomyces ...
Q6BJD8       445 TLVYTKLMMACKRSRGIKEARGVFKQARnNFEAIGYEFYVENALMEYH-SDNLKTASKIFELGMKHFKKQGEFLLAYLDF 523  Debaryomyces h...
Q5AM44       482 TLTYVKFMIASKRSEGIKEARNVFKQAR-KFTDIGYQIFIESALLEHY-SDKKSTALKIFDLGKKNFATNGKFLLNYLDY 559  Candida albica...
6URO_E       454 LSHLNEDNNTRVLFERVLTsgS--LPPEK---------------------------------SGEIWARFLAFESNIGDL 498 
Q4PCV8       702 LISMNDDSNARALFERVIG--T--FAPER---------------------------------ARPIWERWAKYEYNFGDS 744  Ustilago maydi...
EDO40717     470 LSHLNDDNNTRVLFEKVLS--T--MPKEK---------------------------------ASDVWTKFIEFETTSGDL 512  starlet sea an...
XP_020797035 454 LSHLNEDNNTRVLFERVLT--SgnLSPEK---------------------------------SGEIWARFLAFESNIGDL 498  great blue-spo...
Q0IFE2       454 LSHLNEDNNTRVLFERVLS--SggLTPQL---------------------------------SVEVWNRFLEFESNIGDL 498  yellow fever m...
P25991       487 LSHLNEDNNTRVLFERVLS--SggLSPHK---------------------------------SVEVWNRFLEFESNIGDL 531  fruit fly
Q8GUP1       412 LTRLNDDRNIRALFERALS--T--LPVED---------------------------------SAEVWKRFIQFEQTYGDL 454  thale cress
P25298       493 LIFLNKDSQIKTLFETSVE--K--VQDLTq--------------------------------LKEIYKKMISYESKFGNL 536  Saccharomyces ...
Q6BJD8       524 LIMINKGESIKVLFEQGLT--A--LLQDVnienensngditsganmrlqeskskenikkkncIKKLIKKFSRYQSVYGDL 599  Debaryomyces h...
Q5AM44       560 LIMINDVDTMRTVIQSSDA--N--FTKEIgnlqeelkltnldpi---trkklekqitnlkkfLKQLYKKYISFAATFLSL 632  Candida albica...
6URO_E       499 ASILKVEKRRFTAFKE---------EyegKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAII----------- 558 
Q4PCV8       745 VAIQKLESRLAETYPD---------E---PATKRFIARSSYMDLDLVGPRDLGIRAAMAGASAADRAVEaakdggaeegp 812  Ustilago maydi...
EDO40717     513 SSILKVEKRRLQVYKEef------eQ---HETAVLVDRYRFLDLLPCSPMELKIMGYTGPSRHVTSISTa---------- 573  starlet sea an...
XP_020797035 499 ASILKVERRRFAAFKDey------eG---KETALLVDRYKFMDLYPCSTSELKALGYKDVSRAKLAALLpet-------- 561  great blue-spo...
Q0IFE2       499 SSIVKVERRRSAVLEKlke----feG---KETAQLVDRYKFLNLYPCSSAELKSIGYTETDGILNP-------------- 557  yellow fever m...
P25991       532 SSIVKVERRRSAVFENlke----yeG---KETAQLVDRYKFLDLYPCTSTELKSIGYAENVGIILNKVGgg--------- 595  fruit fly
Q8GUP1       455 ASILKVEQRMKEALSGkgeegssppE---SSLQDVVSRYSYMDLWPCTSNDLDHLARQELLVKNLNKKAgkt-------- 523  thale cress
P25298       537 NNVYSLEKRFFERFPQ---------E---NLIEVFTSRYQIQNSNLIKKLELTYMYNEEEDSYFSSGNGd---------- 594  Saccharomyces ...
Q6BJD8       600 DLIKSLDSRYEEYFPD---------D---DSIELFSDRYRGHSIDVIKHFDLGKEDTSHEEIDTT--------------- 652  Debaryomyces h...
Q5AM44       633 DVTHSFAKKCEQLFPK---------D---DPIDLFTDRYKLDNINIIKKDELGRDDILTSFDGIIDEEE----------- 689  Candida albica...
6URO_E       559 PDPVVAPSIVPVLKDEVDRKPe-yPKPDTQQMIPF--------------------------QPRHLAPPGLHPVPGGVFP 611 
Q4PCV8       813 RRKTMQEMKRLAAESAQDDTSgdwARPGASSSAGGaggppvk------------kfkrdsaSPAPAAFNNQAVGQQVAGP 880  Ustilago maydi...
EDO40717     574 -----qSSTDNPLEEVKEEKTvrfPLPDTSQMTp--------------------------fKPTAGAAKCLKIGGGFRAS 622  starlet sea an...
XP_020797035 562 ----vvAPSVPILKDEIDRKPe-yPKPDTNQMIp--------------------------fQPRHLAPPGLHPVPGGVFP 610  great blue-spo...
Q0IFE2       558 ------ISTKHSTPVEAPEQPhkiPRPDFAQMIp--------------------------yKPKPNAYPGEHPLDGGAFP 605  yellow fever m...
P25991       596 ----aqSQNTGEVETDSEATPp-lPRPDFSQMIp--------------------------fKPRPCAHPGAHPLAGGVFP 644  fruit fly
Q8GUP1       524 ------nlPHVPAAIGSVASSskvVYPDTSQMVVQdptkksefassanpvaasasntfpstVTATATHGSASTFDEIPKT 597  thale cress
P25298       595 -------gHHGSYNMSSSDrkr------------------------------------lmeETGNNGNFSNKKFKRDSE- 630  Saccharomyces ...
Q6BJD8       653 ------AQETKRRKIQNPTvdeft---------------------------------pevsNNNNQHTNNKDAVQNQQQP 693  Debaryomyces h...
Q5AM44       690 ------LQRLKRRKLSNGSGSsssysfne------------------------eesksaikNIEEQKTRVQQEQDQENQG 739  Candida albica...
6URO_E       612 --------VPPAAVVLMKLLPPPICFQGP---FVQVDELMEIFR-RCKIP 649 
Q4PCV8       881 rda--wneFPESVLVFMEMLPSAQLFDGP---MFKPEDIIDCIR-SANVP 924  Ustilago maydis 521
EDO40717     623 --------PPPP-------LEPPPLFNGP---FVVIEELMRLFA-ECTLP 653  starlet sea anemone
XP_020797035 611 --------VPPAAVVLMKLLPPPTCFTGP---FVQVDELMETFR-RCTLP 648  great blue-spotted mudskipper
Q0IFE2       606 --------QPPALAALCSMLPPPICFHGP---FVSVDKLQDLFS-RIVLP 643  yellow fever mosquito
P25991       645 --------QPPALAALCATLPPPNSFRGP---FVSVELLFDIFM-RLNLP 682  fruit fly
Q8GUP1       598 --------TPPALVAFLANLPIV---DGP---TPNVDVVLSICL-QSDFP 632  thale cress
P25298       631 --------LPTEVLDLLSVIPKRQYFNTN---LLDAQKLVNFLNdQVEIP 669  Saccharomyces cerevisiae S288C
Q6BJD8       694 qn-----fVGNTIYNLLRVLPNSSYFGPPsdhLFNNTKLVELFG---NLP 735  Debaryomyces hansenii CBS767
Q5AM44       740 inkpeesfVGPSIIALMSALPNASYFGLPsesVFNSEKLVTLFAnLSNIP 789  Candida albicans SC5314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap