Conserved Protein Domain Family
TelA

?
pfam05816: TelA 
Toxic anion resistance protein (TelA)
This family consists of several prokaryotic TelA like proteins. TelA and KlA are associated with tellurite resistance and plasmid fertility inhibition.
Statistics
?
PSSM-Id: 399074
Aligned: 146 rows
Threshold Bit Score: 196.187
Threshold Setting Gi: 81787054
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q28R93          46 RLRVAEIDmtdtnSIVSFGSSAQAELQQISQAMLA------------GVKNKDAGPAGDSLREIVGTIRGFSVdeldPN- 112 Jannaschia sp...
jgi:Sked_37530  63 PELQAKIT-----EITTLGRDEIQGAANASNRMLErpasalaaakgsGDAGDAQARVAKTLTDLRFQVEDLTPnr-aDLt 136 Sanguibacter ...
WP_015748235    70 PEFAKKIE-----AITALGDREMRESANVSSRMLDrpaavl-sgakgGGGGDAQTRVAKTLSDLRVTITELDPnr-aDLt 142 Nakamurella m...
jgi:Celf_0209   74 PAFSQKVA-----SITSMGDQDMRAAATVSSRMLDrpaa----iakgKSTGDAQTRVANTLVDLRNTVTDLDPnr-aDLt 143 Cellulomonas ...
Q3SGS7          63 eEFRVKLD-----AANALGRQSIANASALTGRFMDksf-----------vgfSDSLAFKTINELRGVFAELNParagDLl 126 Thiobacillus ...
jgi:Deima_0412  57 DAFKQKVQ-----AVHDLGSEEIRRAASSSNRLLEkpvq-----alsQGADNPQTKVSTTLVDLRKTVEDLDPnragDLf 126 Deinococcus m...
WP_014684672    62 PEFRRKLD-----AVHDLGLPEQRAAAQSSNRMLErplr-----atrAGALAEGSEILKGLTDLRRTVEDLDPsra---p 128 Deinococcus g...
Q4FPW1          64 seFQQNVQ-----SIHNLGNKEIRESAQVSNRMLElpa------kslNDSLFDNSPIAKSLTELRGIVEDLDPsk-kELt 131 Psychrobacter...
Q607X0          60 EEFKARLA-----GAHTLGNEEIRAAAGISNRLLEkpmr-----amsAGVFDSGSDISRALLDLRAKVEELDPsrqgNLl 129 Methylococcus...
jgi:Daci_0765   72 pafkgAVE-----RIHGMGNKEVQAAAAVSNRMLErpvk-----tlnNGLFDQGSQIGQGLIDLRRQVEALDPsrqdDLf 141 Delftia acido...
Q28R93         113 --RKq-SWWErlfgkAK-PIHDFMAKYEDVQEQIDKITDNLLQHEHVLMKDIKSLDKLYEKTLDFYDELALYIAAGEEkl 188 Jannaschia sp...
jgi:Sked_37530 137 gaRKilGFIP-----GGsKIARYFDRYKSAQVQLDSITRALESGQDELRKDNASIEQEKVNLWNTMGTLSEYAVLLGG-- 209 Sanguibacter ...
WP_015748235   143 giKKvlKWIP-----GGdKIDRYFAKYQSAQSHLDAIVRALASGKDELGKDNASIEVEKSNMWTLMGKLTEYNELATA-- 215 Nakamurella m...
jgi:Celf_0209  144 gaKKvlKWLP-----GGsKIDAYFARYQSAQQHLDAIIKSLASGQDELRKDNAAIETEKANLWASMGRLAEYNQLASA-- 216 Cellulomonas ...
Q3SGS7         127 saHKlfGLIP-----YGtKLQAYFRKFDSAGGEIAMLMSELRTAQDEIKRDLTALAEMEGQLWEGMGRIREAAFFAEK-- 199 Thiobacillus ...
jgi:Deima_0412 127 kpRKilGLFP-----GGnRLRDYFLKYESAQKHLNAIVTSLYDNKDELLKDNAAIEQEKTNLWGIMQKLKGYIYVGQQ-- 199 Deinococcus m...
WP_014684672   129 tpRRlfGMLP-----GAkKVQNHLDKYQSAQGHLNGILESLYRGQDELRRDNAVIETEKVHLWETMQKLRQYAHVGKA-- 201 Deinococcus g...
Q4FPW1         132 ssRKlfGLIP-----FGnKIQDYFRQYESAQSHINAVVTSLYNGKDELLKDNAMIEQEKINMWELMQSIRQYIYVGKK-- 204 Psychrobacter...
Q607X0         130 epRKllGLIP-----MGsRIHDYFRQYESAQAHINGIIQALYAGQDELRKDNAAIEEEKIQAWKIMEKLEQYAYLGNR-- 202 Methylococcus...
jgi:Daci_0765  142 kpRKllGLIP-----MGnRLVDYFDKFQSSQSHLNAIIDSLKRGKDELLRDNAAIEQEKANLWGLMERLEKYIHIGKK-- 214 Delftia acido...
Q28R93         189 rdLDENVIPAKEAEVQaapEDDqvIK-AQELRDirAARDDLERRVHDLKLTRQVTMQSLPSIRLVQENDKSLVTKINSTL 267 Jannaschia sp...
jgi:Sked_37530 210 --LDAAVEKKITEVEV---SSP--DT-AKAMRS--DVLFAVRQRREDILTQLAVSAQGYLAMDMVRANNVELIKGVDRAR 279 Sanguibacter ...
WP_015748235   216 --LDVAVEDQVRVLES---QGR--TEdANTLRS--DALFPIRQRKQDIMTQMAVAVQGYMALDLVRKNNLELMRGVDRAQ 286 Nakamurella m...
jgi:Celf_0209  217 --LDEALVEKIAQLEA---AGR--QEdADAVRS--DALFPVRQRRQDFMTQMAVSVQGYMALDLVRRNNLELIKGVDRAQ 287 Cellulomonas ...
Q3SGS7         200 --LDVRLAAEVSVLKR---ANP--LK-AEALEQ--EVLFYVRQVHSDLLAQQVVNVNAYRQIGILKKTGRELVNGCDRMA 269 Thiobacillus ...
jgi:Deima_0412 200 --LDGALAARVEQLQA---QDP--EK-ARVVRE--EMLFAARQRVQDLLTQLAVSVQGYLALDLVRKNNLELIKGVDRAT 269 Deinococcus m...
WP_014684672   202 --VDEALSTRLAQLAQ---TDP--EK-ARMVSE--ELLFAVRQRVTDLLTQLAVSIQGYLALDLVRRNNLELIKGVDRAT 271 Deinococcus g...
Q4FPW1         205 --IDEQLEQKVYAIEA---TDP--EK-ARIIKE--EMLFYVRQKNTDFLTQLAVNVQGYLALDTIRKNNLELIKGVDRAT 274 Psychrobacter...
Q607X0         203 --IDAALERKLAEIEA---QDP--EK-ARVVRE--ELQFYVRQKVQDILTQLAVTIQGYLAMDMIRKNNLELIKGVERAT 272 Methylococcus...
jgi:Daci_0765  215 --LDAALEAKAAQLDA---SDP--EK-ARVVRE--DMLFYARQKVTDLLTQMAVNVQGYLALDLVRKNNLELAKGVDRAT 284 Delftia acido...
Q28R93         268 VNTVPLWETQLAQAVTIQRSTEAAKAVKEATDLTNELLTRNAENLRESNRLVRNEMERGVFDIEAVKHANAELVATINES 347 Jannaschia sp...
jgi:Sked_37530 280 TTTLSALRTAVIVAQALTNQRLVLDQITALNKTTSDLIASNAEMLKTTSADIHRQAAASTIEIDKLEKAFQDVFETMDAI 359 Sanguibacter ...
WP_015748235   287 TTTIAALRTAVIVSQALARQKLVLDQITGLNAATGDLIARTSEQLKIQGAQIHEQAASATVSVEKLQQAFDNVFQAMDAV 366 Nakamurella m...
jgi:Celf_0209  288 TTTVAALRTAVIVAQALSRQKLVLDQITALNTVTSNLIESTSEQLRIQGAAINQQASEATLDVAKLQAAFDNVFQTMDAL 367 Cellulomonas ...
Q3SGS7         270 TTGMSALATAQAVARATGAQIKVMDMLNAGSQAIGDLVEQTSVMIGKHVETTGAFASAPVIAVDHLKAAFENTTRAMDAM 349 Thiobacillus ...
jgi:Deima_0412 270 TTTISALRTAVMVSQALGQQKLVLDQISALNASTSAIIENTSKMLQLQTQRTYQQAADTTVDIEALKRSFDNVYGAMDAI 349 Deinococcus m...
WP_014684672   272 TTTVSALKTALMVSQALGTQQAVLGQVTAVNDTTGRMISSTAQLLRQQSTEIQKQAGSATVDPQIIQAAFREVYGALDAI 351 Deinococcus g...
Q4FPW1         275 TTTISALRTAVVVAQAMTNQKLVLDQITALNKTTSSLIESTSAMLKRQSLEIHEQATSSTIELDKLQNAFNNIYDTMDMI 354 Psychrobacter...
Q607X0         273 TTTISALRTAVIVAQALANQKLVLDQVGALRATTGGLIESTSAMLKQQAGRVQEQAGGTAVDLKQLQAAFQNVYETVDRV 352 Methylococcus...
jgi:Daci_0765  285 TTTVSALRTAVIVAQALANQKLVLDQITALNTTTGNLIAGTSELLREQSGKIHEQAASSTIDIAKLQQAFGNIYQTMDAM 364 Delftia acido...
Q28R93         348 LEIADEGKRKRREAEAEMEKMERELRDTLSS 378 Jannaschia sp. CCS1
jgi:Sked_37530 360 DTFRAEAASSMAVTITSLEGQIERAQPYLER 390 Sanguibacter keddieii DSM 10542
WP_015748235   367 DTFRAQAVDSMAQTVNALQGQIDRAQPYLER 397 Nakamurella multipartita
jgi:Celf_0209  368 DTFRAQAVDSMAQTVTALEGQIQRAQPYLER 398 Cellulomonas fimi ATCC 484
Q3SGS7         350 DAFRSQALDIMGKNTQLLKGMIETAEREISa 380 Thiobacillus denitrificans ATCC 25259
jgi:Deima_0412 350 SEYKRTALDQMQQNVQVLAGQVDRAQQYLDR 380 Deinococcus maricopensis DSM 21211
WP_014684672   352 SVYRQQALDRFRDTMQVLDKEVGQAQTYLDR 382 Deinococcus gobiensis
Q4FPW1         355 STYKVEALENMKQTVNTLTTEVDKAQKYLDK 385 Psychrobacter arcticus
Q607X0         353 AAYKLQALDHMRQTVDALTQAVAKSKTYLDR 383 Methylococcus capsulatus
jgi:Daci_0765  365 ADFKVKALASMQTTVDTLSQEVDKSRAYLEK 395 Delftia acidovorans SPH-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap