Conserved Protein Domain Family
Ac76

?
pfam05814: Ac76 
Orf76 (Ac76)
This family consists mainly of baculovirus proteins. Family members include Autographa californica multiple nucleopolyhedrovirus (AcMNPV), protein AC76. Ac76 has been shown to be involved in intranuclear microvesicle formation. Functional studies suggest that ac76 is essential for both BV (budded virus) and ODV (occlusion-derived virus) development but is not required for viral DNA synthesis.
Statistics
?
PSSM-Id: 114536
View PSSM: pfam05814
Aligned: 15 rows
Threshold Bit Score: 74.2558
Threshold Setting Gi: 1175101
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9YMP2  1 MFIYYTFLMLIALGFIFDRNEGISNLLLFMLLVFIIFILMLQVMYI--KPESSdAADLQTGKAKSIKKKRDLERAFDAIL 78  Lymantria dispar multi...
Q0N432  1 MTLFATFLVLILIGFLFDKNDGLLNVMLYLFMLFVVFIFLLQIYYI--KPQST-TADLQTGKSKSIKKKRDLERAFDAIL 77  Clanis bilineata nucle...
Q462B3  1 MFMYFTFLVLILLGFIFDKNEGFSNLLLFMLLLFVTFIMLLQIYYI--KPEST-TADLPTVKAKSIKKKRDLERAFDAII 77  Trichoplusia ni single...
Q06690  1 MNLYLLLGALAIFSLVYDKKE--NSIFLYLLILFLVFII-VSPAIIskNTEST-VEDIPSHKAKSVRKKLEIEQALDAIL 76  Autographa californica...
Q91BF2  1 MLIFFTFI-LITLSFIFDRNNGMSNLILFVLLLFIIFVALLHVYYV--KPASN-TTDLQTDKSKRIKKKRDLEKALDAII 76  Spodoptera litura nucl...
Q0IL31  1 MFIYLAFALLITLSFIFDKTKSMSNLIVFVLLLCVVFIILLNVYYV--KPPST-TADLQTDKSKRTKKKRDLEKALDAII 77  Leucania separata nucl...
Q9DVU2  1 MLL--GLIAFIIIALLMNKTAMGSELIITCLILFVLFFCILNVYYV--NNEST---DLYTADTKKIKKRQQLSDAFDAIL 73  Plutella xylostella gr...
Q8JRV9  1 MLTISLVVGLVVFAFIINRYTTSSEMIVTMLVLVVLFFCILNYYYS--NTDSA-PQDLYNDNIRKMKKKQHLNEAFDTLL 77  Phthorimaea operculell...
Q7T5J5  1 MLTPTLIIGLIVFAFLVNKF-NSSELLVTVMVLFVLFFCILNYYYA--STESA-PQDLYNENVKKMKKKQHLNDAFDALL 76  Cryptophlebia leucotre...
Q6QXL9  1 MSIITPVIALVVLAFLLNTAFRGSELIITILVLLVLFFCVLHIHYV--NNESG-PDTLFNEQTKKLKKKQQINDAFDAIL 77  Agrotis segetum granul...
Q9YMP2 79 NKNTSS 84  Lymantria dispar multiple nucleopolyhedrovirus
Q0N432 78 NKNTSS 83  Clanis bilineata nucleopolyhedrovirus
Q462B3 78 NKNTSS 83  Trichoplusia ni single nucleopolyhedrovirus
Q06690 77 NKNTSS 82  Autographa californica nucleopolyhedrovirus
Q91BF2 77 NKNTSS 82  Spodoptera litura nucleopolyhedrovirus
Q0IL31 78 NKNTSS 83  Leucania separata nucleopolyhedrovirus
Q9DVU2 74 NKNNSS 79  Plutella xylostella granulovirus
Q8JRV9 78 NKNNSL 83  Phthorimaea operculella granulovirus
Q7T5J5 77 NKNNSS 82  Cryptophlebia leucotreta granulovirus
Q6QXL9 78 NKNNSS 83  Agrotis segetum granulovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap