6PNS


Conserved Protein Domain Family
Orbi_VP1

?
pfam05788: Orbi_VP1 
Orbivirus RNA-dependent RNA polymerase (VP1)
This family consists of the RNA-dependent RNA polymerase protein VP1 from the Orbiviruses. VP1 may have both enzymatic and structural roles in the virus life cycle.
Statistics
?
PSSM-Id: 399064
Aligned: 3 rows
Threshold Bit Score: 2625.16
Threshold Setting Gi: 133596
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6PNS_A    6 VQGAQLIKRVVERFYPGIAFNINEGACYIYKFSDHIRRIRMKHGTKYRRQAEEIIRNISLRKERLYGIPVLDEVEWKYVF 85  
P13840    6 VQGAQLIKRVVERFYPGIAFDINEGACYIYKFSDHIRRIRMKHGTKYRRQAEEIMRSISLRKERLYGIPVLDEVEWKYVF 85   Bluetongue virus (s...
P13840    6 VQGAQLIKRVVERFYPGIAFDINEGACYIYKFSDHIRRIRMKHGTKYRRQAEEIMRSISLRKERLYGIPVLDEVEWKYVF 85   Bluetongue virus (s...
6PNS_A   86 DGQTFQSYAFEVYVNSILPWSELDPEEEFLRNYRVSREMTEVEKFIEFRAKNEMQIYGDIPIKVWCCFINELSAELKHVP 165 
P13840   86 DGQTFQSYAFEVYVNSILPWSELDPEEEFLRNYRVSRETTEVEKFIEFRAKNEMQIYGDIPIKVWCCFINELSIELNPIP 165  Bluetongue virus (s...
P13840   86 DGQTFQSYAFEVYVNSILPWSELDPEEEFLRNYRVSRETTEVEKFIEFRAKNEMQIYGDIPIKVWCCFINELSIELNPIP 165  Bluetongue virus (s...
6PNS_A  166 LGMQVMADFVNRFDSPFHQGNRDLSNLEDFQVAYTTPLLFEMCCMESILEFNIKMRMREEEISALEFGDMKVDPVGLLRE 245 
P13840  166 LGMQVMADFVNRFNSPFHQGNRDLSNLEDFQVAYTTPLLFEMCCMESILEFNIKMRMREEDISALEFGDIKIDPVGLLRE 245  Bluetongue virus (s...
P13840  166 LGMQVMADFVNRFNSPFHQGNRDLSNLEDFQVAYTTPLLFEMCCMESILEFNIKMRMREEDISALEFGDIKIDPVGLLRE 245  Bluetongue virus (s...
6PNS_A  246 FFILCLPHPKKINNVLRAPYSWFVKMWGVGADPIVVLQSTAGDDRNSKDVFYDKFRTEPNRYKALFRSSFYNESRRMNEE 325 
P13840  246 FFILCLPHPKKINNVLRAPYSWFVKMWGVGADPIVVLQSTAGDDRNSKDVFYDKFRTEPNRYKALFRSSFYNESRRMNEE 325  Bluetongue virus (s...
P13840  246 FFILCLPHPKKINNVLRAPYSWFVKMWGVGADPIVVLQSTAGDDRNSKDVFYDKFRTEPNRYKALFRSSFYNESRRMNEE 325  Bluetongue virus (s...
6PNS_A  326 KILEAVKYSQKLGSHDRRLPLFEKMLKTVYTTPFYPHKSSNMILASFLLSIQTITGYGRAWVKNVSTEFDKQLKPNPSNL 405 
P13840  326 KILEAVKYSQNLGSHDRRLPLFEKMLKMVYTTPFYPHKSSNMILASFLLSIQTITGYGRAWVKNVSTEFDKQLKPNPSNL 405  Bluetongue virus (s...
P13840  326 KILEAVKYSQNLGSHDRRLPLFEKMLKMVYTTPFYPHKSSNMILASFLLSIQTITGYGRAWVKNVSTEFDKQLKPNPSNL 405  Bluetongue virus (s...
6PNS_A  406 VQDVSDLTREFFKQAYVEAKERREEIVKPEDLYTSMLRLARNTSSGFSTEIYVKKRFGPRLRDKDLIKINSRIKALVIFT 485 
P13840  406 VRDVSDLTREFFKQAYVEAKERREEMVKPEDLYTSMLRLARNTSSGFSTEIYVKKRFGPRLRDKDLVKINSRIKALVIFT 485  Bluetongue virus (s...
P13840  406 VRDVSDLTREFFKQAYVEAKERREEMVKPEDLYTSMLRLARNTSSGFSTEIYVKKRFGPRLRDKDLVKINSRIKALVIFT 485  Bluetongue virus (s...
6PNS_A  486 KGHTVFTDEELHKKYNSVELYQTKGSRDVPIKATRTIYSINLSVLVPQLIVTLPLNEYFSRVGGITSPDYKKIGGKVIVG 565 
P13840  486 KGHTVFTDEELHKKYNSVELYQTKGSRDVPIKATRTIYSINLSVLVPQLIVTLPLNEYFSRVGGITRPDYKKIGGKVIVG 565  Bluetongue virus (s...
P13840  486 KGHTVFTDEELHKKYNSVELYQTKGSRDVPIKATRTIYSINLSVLVPQLIVTLPLNEYFSRVGGITRPDYKKIGGKVIVG 565  Bluetongue virus (s...
6PNS_A  566 DLEATGSRVMDAADCFRNSADRDIFTIAIDYSEYDTHLTRHNFRTGMLQGIREAMAPYRDLRYEGYTLEQIIDFGYGEGR 645 
P13840  566 DLEATGSRVMDAADCFRNSADRDIFTIAIDYSEYDTHLTRHNFRTGMLQGIREAMAPYRALRYEGYTLEQIIDFGYGEGR 645  Bluetongue virus (s...
P13840  566 DLEATGSRVMDAADCFRNSADRDIFTIAIDYSEYDTHLTRHNFRTGMLQGIREAMAPYRALRYEGYTLEQIIDFGYGEGR 645  Bluetongue virus (s...
6PNS_A  646 VANTLWNGKRRLFKTTFDAYIRLDESERDKGSFKVPKGVLPVSSVDVANRIAVDKGFDTLIAATDGSDLALIDTHLSGEN 725 
P13840  646 VANTLWNGKRRLFKTTFDAYIRLDESERDKGSFKVPKGVLPVSSVDVANRIAVDKGFDTLIAATDGSDLALIDTHLSGEN 725  Bluetongue virus (s...
P13840  646 VANTLWNGKRRLFKTTFDAYIRLDESERDKGSFKVPKGVLPVSSVDVANRIAVDKGFDTLIAATDGSDLALIDTHLSGEN 725  Bluetongue virus (s...
6PNS_A  726 STLIANSMHNMAIGTLMQREVGREQPGVLTFLSEQYVGDDTLFYTKLHTTDTKVFDKVAASIFDTVAKCGHEASPSKTMM 805 
P13840  726 STLIANSMHNMAIGTLIQRAVGREQPGILTFLSEQYVGDDTLFYTKLHTTDITVFDKVAASIFDTVAKCGHEASPSKTMM 805  Bluetongue virus (s...
P13840  726 STLIANSMHNMAIGTLIQRAVGREQPGILTFLSEQYVGDDTLFYTKLHTTDITVFDKVAASIFDTVAKCGHEASPSKTMM 805  Bluetongue virus (s...
6PNS_A  806 TPYSVEKTQTHAKQGCYVPQDRMMIISSERRKDIEDVQGYVRSQVQTMITKVSRGFCHDLAQLILMLKTTFIGAWKMKRT 885 
P13840  806 TPYSVEKTQTHAKQGCYVPQDRMMIISSERRKDIEDVQGYVRSQVQTMITKVSRGFCHDLAQLILMLKTTFIGAWKMKRT 885  Bluetongue virus (s...
P13840  806 TPYSVEKTQTHAKQGCYVPQDRMMIISSERRKDIEDVQGYVRSQVQTMITKVSRGFCHDLAQLILMLKTTFIGAWKMKRT 885  Bluetongue virus (s...
6PNS_A  886 IKEDAMYRDRKFDSNDEDGFTLIQIRNPLALYVPIGWNGYGAHPAALNIVMTEEMYVDSIMISKLDEIMAPIRRIVHDIP 965 
P13840  886 IKENAMYRDRKFDSNDEDGFTLIQIRNPLALYVPIGWNGYGAHPAALNIVMTEEMYVDSIMISKLDEIMAPIRRIVHDIP 965  Bluetongue virus (s...
P13840  886 IKENAMYRDRKFDSNDEDGFTLIQIRNPLALYVPIGWNGYGAHPAALNIVMTEEMYVDSIMISKLDEIMAPIRRIVHDIP 965  Bluetongue virus (s...
6PNS_A  966 PCWNETQGDKRGLISATKMSFFSKMARPAVQAALSDPQIINLVEELPLGEFSPGRISRTMMHSALLKESSARTLLSSGYE 1045
P13840  966 PCWNETQGDKRGLISATKLSFFSKMARPAVQAALSDPQIMNLVEELPLGEFSPGRISRTMMHSALLKESSAKALLSSGYR 1045 Bluetongue virus (s...
P13840  966 PCWNETQGDKRGLISATKLSFFSKMARPAVQAALSDPQIMNLVEELPLGEFSPGRISRTMMHSALLKESSAKALLSSGYR 1045 Bluetongue virus (s...
6PNS_A 1046 LEYQKALNSWITQVSMRLGEESGVISTSYAKLFDVYFEGELDGAPHMFPDQNLSPQFYIQKMMIGPRVSSRVRNSYVDRI 1125
P13840 1046 LEYQKALNGWIAQVSMRLGEESGVISTSYAKLFDVYFEGELDGAPYMFPDQNLSPQFYIQKMMIGPRVSSRVRNSYVDRI 1125 Bluetongue virus (s...
P13840 1046 LEYQKALNGWIAQVSMRLGEESGVISTSYAKLFDVYFEGELDGAPYMFPDQNLSPQFYIQKMMIGPRVSSRVRNSYVDRI 1125 Bluetongue virus (s...
6PNS_A 1126 DVILRKDVVMRGFITANTILNVIEKLGTNHSVGDLVTVFTLMNIETRVAEELAEYMTSEKIRFDALKLLKKGIAGDEFTM 1205
P13840 1126 DVILRKDVVMRGFITANTILNVIEKLGTNHSVGDLVTVFTLMNIETRVAEELAEYMTSEKIRFDALKLLKKGIAGDEFTM 1205 Bluetongue virus (s...
P13840 1126 DVILRKDVVMRGFITANTILNVIEKLGTNHSVGDLVTVFTLMNIETRVAEELAEYMTSEKIRFDALKLLKKGIAGDEFTM 1205 Bluetongue virus (s...
6PNS_A 1206 SLNVATQDFIDTYLAYPYQLTKTEVDAISLYCTQMIMLRAALGLPKKKMKIVVTDDAKKRYKIRLQRFRTHVPKIKVLKK 1285
P13840 1206 SLNVATQDFIDTYLAYPYQLTKTEVDAISLYCTQMVMLRAALGLPKKKMKIVVTDDAKKRYKIRLQRFRTHVPKIKVLKK 1285 Bluetongue virus (s...
P13840 1206 SLNVATQDFIDTYLAYPYQLTKTEVDAISLYCTQMVMLRAALGLPKKKMKIVVTDDAKKRYKIRLQRFRTHVPKIKVLKK 1285 Bluetongue virus (s...
6PNS_A 1286 LIDPNRMTVRNLENQFV 1302
P13840 1286 LIDPNRMTVRNLENQFV 1302 Bluetongue virus (serotype 10 / American isolate)
P13840 1286 LIDPNRMTVRNLENQFV 1302 Bluetongue virus (serotype 10 / American isolate)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap