Conserved Protein Domain Family
ECM1

?
pfam05782: ECM1 
Extracellular matrix protein 1 (ECM1)
This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalized thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness.
Statistics
?
PSSM-Id: 399061
Aligned: 11 rows
Threshold Bit Score: 843.327
Threshold Setting Gi: 612000709
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_012903466   5 SRAALVLACLAVTSVASEGGSESPGQRELGPETLTYHIQE--VGYAAPPSPPRTRAl--PM-DHPDTHQR--------Gs 71  domestic ferret
XP_012667220   5 SRAAWVLAYLAVASVASEGDLKAPGQRELRPEHFMQHFHE--VGYAAPPSPPLSQSl--PM-DHPDASQH--------Gp 71  small-eared galago
Q16610         5 ARAALVLTYLAVASAASEGGFTATGQRQLRPEHF----QE--VGYAAPPSPPLSRSl--PM-DHPDSSQH--------Gp 67  human
XP_003498694   5 SRAALILASLALASVASAGASKPSEQREMKPENLFLHLHE--VGYAAPPSPPQTRGl--RVdDHFETSLH--------Ds 72  Chinese hamster
Q61508         5 SRAALILACLALASAASEGAFKASDQREMTPERLFQHLHE--VGYAAPPSPPQTRRl--RV-DHSVTSLH--------Dp 71  house mouse
XP_013216683   5 ARVALVLACLAVASATSEGGHEAPGQKELRSEYI----QE--AGYAAPPSPPQARGf--PV-YHLDPSQY--------Dl 67  thirteen-lined ...
XP_003478933   5 SRAAVILACVAVISAASEKGFTPVRQREPRPLHPIQRFEE--VGYAEPPSPPVSRSrglPAgPH-DSSQR--------Dp 73  domestic guinea...
XP_001370788  12 alaalllmllalgaSAQGGPSEQ--------REAIPEHFPkeVGYAAPPAPSSPQK---PDlQDLVIS-HrafegqteAq 79  gray short-tail...
XP_006095273   5 FGAALVLACLAVTSTASEGGFKPSSQRELGPEYL----QE--VGYAAPPSPPLTRAr--PR-DHPEISLH--------Dp 67  little brown bat
XP_012405145  12 RTAALVLVVWALGASASHGGPKPSEQRESIPQFFLFSQEE--VGYAAPPAPPRPQE---PSlQDPVTPQH--------I- 77  Tasmanian devil
XP_023403142   5 SRAALVLACLAVASAASEG------------------------------------------------------------- 23  African savanna...
XP_012903466  72 -dFEGQ--GEVQ-PPRSLEAIPIQEEELPPPQLPVENKv---------DPHFPQEAIPLQEE-LPPPQDPVEQKEIEp-S 136 domestic ferret
XP_012667220  72 -lLEGQ--SEVQ-PLPPQEAIPVQEEEMPPPQVPLEKT----------DLPHPQEAIPAQEEnLPPPQLSIEQKEVE--P 135 small-eared galago
Q16610        68 -pFEGQ--SQVQ-PPPSQEATPLQQEKLLPAQLPAEKEv---------GPPLPQEAVPLQKE-LPSLQHPNEQK------ 127 human
XP_003498694  73 -lFEGQ--REVE-PPASPEVPFVQEEEWPASPKSVKSEv---------GPPTPQEAIPLQEK-QPPPQVSIEQKEIDp-Y 137 Chinese hamster
Q61508        72 plFEEQ--REVQ-PPSSPEDIPVYEEDWPTFLNPNVDKa---------GPAVPQEAIPLQKE-QPPPQVHIEQKEIDp-P 137 house mouse
XP_013216683  68 -pFEGQ--REVQ-SPPSPEAIPVQEE-LPPPHLSNGKKv---------DPPLPPEAIPLQEE-LPPPHPRTEQKEIS--- 129 thirteen-lined ...
XP_003478933  74 -sFEGQ--MEVNfPYVSQEEIPLQKE-VPPLQHPNAKRv---------DTPGPQEEIPLQQE-VTPLRHPTGQKQMGs-P 138 domestic guinea...
XP_001370788  80 dfFEDFplQQAQ----SPQKLSLGKK-----------------------EPSPSRAVPIQKEvEPPRHLPMDQREAQssS 132 gray short-tail...
XP_006095273  68 -dFEGQ--SEVQ-PFSSFD----QEEQLFSPQLLVRSGslslsgsqaeDPTGPGRVVPVQEElLPPPG-PIEQKELDapP 138 little brown bat
XP_012405145  78 --FVGQe-----tVDYLFEDFPVQQAQSPQRIPLE--Tg---------IESTPNEAIPLQKE-VHAPQLPIEQKEVEspF 138 Tasmanian devil
XP_023403142  24 ----------AQ-TPPSQEAIPVQTEELPPRQLPVERK----------DHPLPHGAIPIQEE-LPPPQLPVEQKEVDp-P 80  African savanna...
XP_012903466 137 FLHQEEMTFPSKQR-------E-----EKPAPFMDRSSPEPES--WNPALHCQQGRSRGGWGHRLDGFPPGRPSPDNLDQ 202 domestic ferret
XP_012667220 136 ALSQAEMIFQPKQR-------E-----GKPAALVSQSHPEPET--WNPAQHCQRGRSRGGWSHRLDGFPPGQPSSDNLNQ 201 small-eared galago
Q16610       128 ---------------------E-----GTPAPFGDQSHPEPES--WNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQ 179 human
XP_003498694 138 AQQQEE-FIHTGQK-------E-----EKPAPSVVQGSPGPRS--WNPAQHCQQGR-RGGWGYRLDGFPPGRPSPDNLNQ 201 Chinese hamster
Q61508       138 AQPQEEIV----QK-------E-----VKPHTLAGQLPPEPRT--WNPARHCQQGR-RGVWGHRLDGFPPGRPSPDNLKQ 198 house mouse
XP_013216683 130 ------------QS-------E-----EKPAPPMRQDPPEPHS--WNPAQHCQQGRFRGGWGYRLDGFPPGRPSPDNLNQ 183 thirteen-lined ...
XP_003478933 139 VTHQKE-IFPSGQT-------E-----EKSGPLTGQGPSDPQS--WNPAQHCQRGRFRGGWGHRLEGFPPGRPSADNLNQ 203 domestic guinea...
XP_001370788 133 PALESEEIPHQEQK-------E-----VIPSQFGELPPALGEE--HQQPRRCRPEGRPVGWGHRLDSFPPGRPSPKNMHQ 198 gray short-tail...
XP_006095273 139 LPAQEERTSPPKQG-------EatqseEKPAPTSQHG----------PGQHCQQGGPQRCWGQRLDGFPPGRPSPDNLDQ 201 little brown bat
XP_012405145 139 HPPKDDGFPQQEQKeidfsqdE-----EHPNGQREMEHPNPGSspYNQPRHCPQDPRFGGWGHRLDGFPPGRPSPDNIDQ 213 Tasmanian devil
XP_023403142  81 FPQQEEITFGSKQR-------Q-----KKPAHSLGQGHPEPES--WNPAQHCQRGRPRGGWGHRLDGFPPGRPSPDNLNQ 146 African savanna...
XP_012903466 203 ICLPNRQHVVYGPWNLPQSGFSHLTRQGETLNLLETGYSRCCRCHshTNRLDCAKLVWEDAMTRFCEAEFSVKTRPHWCC 282 domestic ferret
XP_012667220 202 ICLPDRQHVLYGPWNLPQSGYSHLTRQGETLNFLETGYSRCCRCRshTQRLDCAKLVWEDAMTRFCEAEFSVKTRAHWCC 281 small-eared galago
Q16610       180 ICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRshTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCC 259 human
XP_003498694 202 ICLSERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRshTNRLDCAKLVWEDTMTRFCEAEFSVKTRPHRCC 281 Chinese hamster
Q61508       199 ICLPERQHVIYGPWNLPQTGYSHLSRQGETLNVLETGYSRCCRCRsdTNRLDCLKLVWEDAMTQFCEAEFSVKTRPHLCC 278 house mouse
XP_013216683 184 ICLPERQHVVYGPWNLPQSGYSHLSRQGETLNLLETGYSRCCRCRshTNRLDCARLVWEDAMTRFCEAEFSVKTRPHWCC 263 thirteen-lined ...
XP_003478933 204 ICLPDRQPVLYGPWNLPQTGYSHLSRQGETLNLLETGYSRCCRCQstTHRLECAKLVWENSMTQFCEAEFSVKTRPYSCC 283 domestic guinea...
XP_001370788 199 ICHPERKHVVYGPWNLPQTGYSHLSRQGNALNFLETGYTRCCHLP--KDQLDCAEFVWADALFRFCESEFSVKTRAYSCC 276 gray short-tail...
XP_006095273 202 ICLPTRQHVVYGPWDLPQSGYSHLSRQGETLNMLETGYSRCCRCHyyAKRMDCAKLVWENAMNQYCEAEFSVKTRPHWCC 281 little brown bat
XP_012405145 214 ICLPDRKHVVYGPWNLPQTGHSHLSRQGNALNFLETGYTRCCHLK--MGRLDCAASVWADALFRFCESEFSVKTRAYSCC 291 Tasmanian devil
XP_023403142 147 ICLPGRQHVVYGPWNLPQTGYSHLIRQGEALNLLETGYSRCCRCSshTNRLDCAKLAWEDAMTQFCEAEFSVKTRAYGCC 226 African savanna...
XP_012903466 283 KQQGEARFSCFQEEAPRPHYQL--RACPSHQPGISSGPELPFPPGVPTLDNVKNICHLRRFRSVPRNLPATDPIQRQLQA 360 domestic ferret
XP_012667220 282 KQQGEARFSCFQKEAPQPHYRL--RACPNHQSGISSGLELPFPPGVPTLDNVKNICHLRRFRSVPRNLPATDPIQRQLQV 359 small-eared galago
Q16610       260 TRQGEARFSCFQEEAPQPHYQL--RACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLA 337 human
XP_003498694 282 KQRGEERFSCFQEEAPQPHYLR--QPCPTHQTGMSSGPQLPFPPGLPTLDNVKNICLLRRFRSVPRNLPATDPIQRQLQA 359 Chinese hamster
Q61508       279 RLRGEERFSCFQKEAPRPDYLL--RPCPVHQNGMSSGPQLPFPPGLPTPDNVKNICLLRRFRAVPRNLPATDAIQRQLQA 356 house mouse
XP_013216683 264 RQQGEARYSCFQEAAPQPHYQL--RACPTHQPGISLGLELPFPPGMPTLDNFKNICHLRRFRSVPRNLPATDPIQRQLHA 341 thirteen-lined ...
XP_003478933 284 KQQGEARFTCFQEGALRPHYQL--QAYPSHQPGISVGLEVPFPPGLPTLDNVNNICHLKRLRYMPRNLPATDTIERQLQV 361 domestic guinea...
XP_001370788 277 WLRGEARLSCFQERAPQADYERlhEPCPPPTPRPAPGLELSFPPGVPSPDNVRNICRLRRFRSVPRGLPTMDHVQRQLRA 356 gray short-tail...
XP_006095273 282 KQQGEARFSCFQEEAPRPHYQL--QAGPSPQPVISTGLELPFPPGLPTLDNIKNICHARRFRSVPRNLPPTDGLQRQLQA 359 little brown bat
XP_012405145 292 WLRGEARLSCFQENAPLPDYKLlqGPCPGHPPRPSSGLAVSFPPGVPTQGNIRNICRFRRYRAVPRGLQILDHLVPQLRA 371 Tasmanian devil
XP_023403142 227 KQQGEARFSCFQEEAPWPQYQP--RACPSQQPGISSGPELPFPPGVPTLDNVRNICLLRRFHSVPRNLQATGHIERQLQA 304 African savanna...
XP_012903466 361 LTRLEGEFQRCCRQGNNHTCTWKAWEDALDGYCDQEQSVKTHHHSCCHYPPSPVRDECFARRAPYPNYDRDILTLDLSRV 440 domestic ferret
XP_012667220 360 LTWLEGEFQRCCRQGDNHTCTWKAWEDSLDRYCDQEHAVKTHPYSCCHYPPSPARDECFARRAPYPNYDRDILTVDISRV 439 small-eared galago
Q16610       338 LIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRV 417 human
XP_003498694 360 LTRLEMAFQRCCRQSHNHTCLRNAWEDTLDEYCDRELAIKTHPHSCCHYPPSPARDECFSRRAPYPNYDRDILTLDLSRV 439 Chinese hamster
Q61508       357 LTRLETEFQRCCRQGHNHTCTWKAWEGTLDGYCERELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDILTLDLSRV 436 house mouse
XP_013216683 342 LTQLEMEFQRCCRQGNNLTCIWKAWEDTLDGYCDKEQATKTHHHSCCHYPPSPARDECFAHQAPYPNYDRDILTLDLGRV 421 thirteen-lined ...
XP_003478933 362 LMQLEVEFQRCCRQGNDHTCARKAWEDALDRYCDQEQAVKTHHHMCCHYPPSPIRDECFAQRAPYPNYDRDILTLDLSRV 441 domestic guinea...
XP_001370788 357 LTQLEGKFRRCCHQGDNYTCARQAWEEALDSYCDEELAIKTHHHVCCQHPASPARDICFARHAPYPNYDRDILTVDLSRI 436 gray short-tail...
XP_006095273 360 LTRLEGELQRCCRRGSNHTCAWKAWEDSLDGYCERELAIKTHHHSCCRYPPSPQRDECFAQKAPYPNYDRDLLTIDLSRI 439 little brown bat
XP_012405145 372 VAQLEGKFKRCCHQGDNYTCARQAWEDVLDNYCDEELAIKTHHHVCCHRSPISARDECFARHAPYPNYDRDILTVDLSRI 451 Tasmanian devil
XP_023403142 305 LTQLERAFQRCCRQEHNHTCAQKAWEDALDRYCDKEQAIKTHQHSCCRHPLSPARDECFARWAPYPNYDRDILTLDVSQV 384 African savanna...
XP_012903466 441 TPNLMGHLCGNGRVLSKHKQIPGLIRNMTAHCCNLPFPEQACCAEEEKLAFIEDLCGPRHNFWRDSALCCNLNPGDEQTN 520 domestic ferret
XP_012667220 440 TPNLMGYLCGKQRVLTKHKQIPGLIQNMTASCCELPFPEQACCAEEEKLAFISDLCGPRRNFWRDPAFCCDLNPGDEQVN 519 small-eared galago
Q16610       418 TPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVN 497 human
XP_003498694 440 TPNLMGHLCGNRRVLTKHKQIPGLIQNMTARCCVLPFPEQACCGEEEKLAFIEDLCGPRKNSWKDPALCCNLSPGDEQAN 519 Chinese hamster
Q61508       437 TPNLMGQLCGSGRVLSKHKQIPGLIQNMTIRCCELPYPEQACCGEEEKLAFIENLCGPRRNSWKDPALCCDLSPEDKQIN 516 house mouse
XP_013216683 422 TPNLMGHLCGNRRVLTKHKQIPGLIQNMTARCCNLPFPEQACCAEEEKSAFVEDLCGPRRNFWRDSAFCCDLSPGDEQTN 501 thirteen-lined ...
XP_003478933 442 TPNLMGHLCGNGRIITKYQHIPGLIRNMTARCCELPFPEQACCAEEEKLAFIEDLCGPRRNFWRDSASCCDRKPEDEQTK 521 domestic guinea...
XP_001370788 437 TPDTMAQLCGHRKVLTKHKHIPGLIRNMTARCCELAPPEQGFCAEEEKSAFIRDLCGSRRDSWRDTESCCDHSPGDEQTC 516 gray short-tail...
XP_006095273 440 TPNLMDYLCGNQRVISKYKQIPGLIRNITARCCDLPLPEQACCAEEEKTSFISYLCGPQRNIWRDPAFCCRMNPGDEQTN 519 little brown bat
XP_012405145 452 TPDVMNQLCGHQKVLTKHKQIPGLIRNMTARCCKLPAAEQGACAEEEKSAFIEDLCGSRRDSWRDSDYCCDEKPGDEQTN 531 Tasmanian devil
XP_023403142 385 TPNLMGHLCGNQRVFTKHKQIPGLIQNMTARCCDLPFPEQACCAEEEKSAFIENLCGPRHNSWQDPARCCDLSPGDKQTN 464 African savanna...
XP_012903466 521 CFNTYYLRNVALVAGDSGDDKGQGKQGQV-XGRSISPTPEPKE 562 domestic ferret
XP_012667220 520 CFNTNYLRNVALVAGDTENAKGQGEQGPTgGTKIGSTLEPKAE 562 small-eared galago
Q16610       498 CFNINYLRNVALVSGDTENAKGQGEQGSTgGTNISSTSEPKEE 540 human
XP_003498694 520 CFNTNYLRNVALVSGDTGDATGQREQDPTgETNVNPAPGSKEE 562 Chinese hamster
Q61508       517 CFNTNYLRNVALVAGDTGNATGLGEQGPTrGTDANPAPGSKEE 559 house mouse
XP_013216683 502 CFNINYLRNVALVAGDTGDARGQGEQVPTgGTNISPTPESKEE 544 thirteen-lined ground squirrel
XP_003478933 522 CFNLNYLRSVALVTGDTGDARG--EQVPTrGTNVSPAPESKEE 562 domestic guinea pig
XP_001370788 517 CFNTHYLRNVALVAGVPQKPRGQQGTGTTeLPLVTPTPEHKGE 559 gray short-tailed opossum
XP_006095273 520 CFNINYLKNVALVAADSGDAKGQGKHDPTqATNTSPPSEP-QE 561 little brown bat
XP_012405145 532 CFNIHYLRNVALVAGVAQKPKDQQETGTTeLPPASPTPEHKGE 574 Tasmanian devil
XP_023403142 465 CFNIQYLRNVAVVAGDTGDAKDPGEQDPNqETNISPTQKPSEE 507 African savanna elephant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap