3FBY


Conserved Protein Domain Family
TSP_C

?
pfam05735: TSP_C 
Thrombospondin C-terminal region
This region is found at the C-terminus of thrombospondin and related proteins.
Statistics
?
PSSM-Id: 399035
Aligned: 31 rows
Threshold Bit Score: 209.034
Threshold Setting Gi: 503733253
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FBY_A        338 QIDPNWVVLNQGREIVQ---TMNSDPGLAVGYTAFNGVDFEGTFHVNT-VTDD--DYAGFIFGYQDSSSFYVVMWKQMEQ 411 
5_pfamImport    1 QIDPNWVIRHQGKELVQ---TANSDPGIAVEVYEFT---LQANWFKDShKI----TYMALTLTHLPTTHMHILHWQSILE 70  
XP_002107975  480 tpaaVFTITDQGSEITQt--NASSLPFILVGYDQFTAVNFTGTLYVNT---QEsrNYIGFVFGYQNNRQFYVVMWRHKNI 554  Trichoplax ad...
XP_011677404  371 dDPPSWYLTDSGKEVHLfnsSSISSPVMLIGSDTLGPVDFRVTMYVNG---DDggNYMGFVFGYQSNRKFYVAMWKHINL 447  purple sea ur...
EKC18263     2243 ekAAVWHIMDKGREVRQt--ETTLKPAAYIGNQYFDHMEFSGTTYAQS---DEcyGYIGFIFGFHSTQKYYLALWRHVHL 2317 Pacific oyster
1_pfamImport    1 --QPEWKISHKGRSVSQp--ISTPFPSMLIGPQRYGSMDFSGSIFVNEeTTSG--NYVGLVFGYHNNKKFYVILWSNSHE 74  
XP_002595072 1767 gaAPSWAVTDDGREIRLt--THTDDPVVLIGDYRFGPVNLTGTMFVNE---DSgnDYIGFVFGYQSNRKFYVVIWKHENE 1841 Florida lancelet
EEN51084     1570 gtAPDWEITDNGRNIRQl--SDTDSPVLLIGRDSFGPVNFTGTMFVSD---DSgnDFIGFVFGYQSNRKFYVVIWKHENE 1644 Florida lancelet
EDO47865      521 dpiPEWHVAVKGIDVEHv--SNSSRPAMLIGETRYGPVDFSGTLYVKG---SSgtDYIGVVFGYQTNQKFYVVMWRKENI 595  starlet sea a...
WP_013967329   42 qgaGSWVLEPGNTAVKQ---VINADPSFFLNNQNTASYSVDGSWEVTT-TSDD--DYMGFVFGYQNSSNFYLFDWKQGTQ 115  Nitrosomonas ...
3FBY_A        412 TYWQANPFRAVAEPGIQLKAVKSSTGPG--EQLRNALWHTGDTESQVRLLWKDPRNV--GWKDKKSYRWFLQHRPQVGYI 487 
5_pfamImport   71 NKGQRFSTHNEGNRGTYLFTHKSTLGAM--SHLKTIKFQLQNIINDVKVFGHKPMQTpvTLKIYTHFETRAVHIVSILPY 148 
XP_002107975  555 NYQGGSTPPEAGIKGIQIKRVNSTTGPS--NALAQALFDTYTTANQVKLLWQDPAMR--GWEHEVAYSFHLVHRPSLGLI 630  Trichoplax ad...
XP_011677404  448 NKETQ----YAGIKGLQIKKVHSTTGPG--ITLANALWHSYTTSNEVELMWHDPLMQ--GWQHRTAYLWRLTYRPSIGII 519  purple sea ur...
EKC18263     2318 NYNI-----YGGIKGVQLRVIETTNNVG--QNYANALYQSYDVTSYSRLLWQDPTLT--GWNCRTSYRWTIQHTPSQGIL 2388 Pacific oyster
1_pfamImport   75 SEDQAAE--KTALKGLQIKVIDSSTGPH--INLANAMWHTYDTTNQVKLIYHDPTLL--GWNARTPYIIVLKHRPSVGSI 148 
XP_002595072 1842 NAESSAT--YGGIKGLQIKVVDSSTGPS--STLADALWHTHDTVNHVTILWHDPDMR--GWIHRTPYTFQLMHRPSVGLI 1915 Florida lancelet
EEN51084     1645 NADGSVG--IGGIKGLQIKIVDSSTGPG--TALATALWHTHDTADQINLLWHDPDMR--GWEHRTPYTFHLIHRPSIGLI 1718 Florida lancelet
EDO47865      596 NFAAANI--NVGIKGVQLKLVDSNVGPG--LELAQAIWHSTDKTDKTKLVWQDPKMA--GWKHETPYQFHIKHRPSIGLI 669  starlet sea a...
WP_013967329  116 GYVG-----QTATEGMTIKEFHGATGDGlvDLSLEEFWENGANFGDMEILATNHTGN--GWNDNVLYNFHLDFNLNPGEI 188  Nitrosomonas ...
3FBY_A        488 RVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCND 535 
5_pfamImport  149 RVVVYEGKQIMADSGPLYDKTYAGGRLGLFVFSQEMVYFSDLKYECKG 196 
XP_002107975  631 RVWIYHGATLLTDSGNVFDTSYSGGRLGAFVYNQPGVIWSRLSYKCID 678  Trichoplax adhaerens
XP_011677404  520 RVTIKSGDVTLTDTGDLYDTTFLGGRLGVFVYDQPDIIFSHMKYDCAD 567  purple sea urchin
EKC18263     2389 RLIVKEGDSTIADSGTLYDVSIPGGRIGVFAYNQTGVIWSDMRFECKD 2436 Pacific oyster
1_pfamImport  149 SVEITNLGNPIINTGPVYDTSYTGGRVGVISFRQSNVIWSNLKVKC-- 194 
XP_002595072 1916 RVTVSSNRRLLTDSGNVYDTTILGGRLGVFQYNQSGVIWSNLQIACGE 1963 Florida lancelet
EEN51084     1719 RVTIANDMEVLTDSGNVYDTTILGGRLGVFQYNQTGVIWSNLRYTCGD 1766 Florida lancelet
EDO47865      670 RIRVFQGETVLTDSGDLYDTTITGGRLGMFVFGQEDVIWSRLEAKCAD 717  starlet sea anemone
WP_013967329  189 HIVVTQGVTELWNV-TVNDSTFSAGQFGFYNNSQEAVRYAGFeitpvp 235  Nitrosomonas sp. Is79A3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap