Conserved Protein Domain Family
TROVE

?
pfam05731: TROVE 
TROVE domain
This presumed domain is found in TEP1 and Ro60 proteins, that are RNA-binding components of Telomerase, Ro and Vault RNPs. This domain has been named TROVE, (after Telomerase, Ro and Vault). This domain is probably RNA-binding.
Statistics
?
PSSM-Id: 399034
Aligned: 24 rows
Threshold Bit Score: 262.712
Threshold Setting Gi: 121973109
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELV13300       56 TSGESKSLPDFMDQTLQEKKMALMSLLCST---VASNVNMKDPD-------DPTRASILEVCSEL-----APLEPEFILK 120  Chinese tree ...
XP_017203654  172 TSEDAASHPEPTDQILQEKKMILMSLLCST---VASNVNMKNGT-------EMTQAFILQVCREL-----APLEPEFILK 236  rabbit
Q231I6         27 NQND-----IQVRVKIDDPKQYLVNVTAAC---LLQEGSYYQDK-------DERRYIITKALLEV-----AESDPEFICQ 86   Tetrahymena t...
WP_011727486   23 VRNAAGGYTFPVDDWARVHRFLTLGTDGGTyytADRELTRDNAEvvl-rvaATDPVGLVNRIVEVseagrAPKANPALFA 101  Mycolicibacte...
Q27274         63 VENNAGGFVFPVSDETQVRRFLILGSDKGSyhqSSEKITIDNAQriikiieQGNGHMVLKELALInaenrNPKMNAMIFT 142  Caenorhabditi...
EGT55430       64 VKNNAGGYVFQTSDETQVRRFIIIGSDKSSyyqSAEKMTMENAQriieiveSGKGHMVLEQLARInaenrNPKMNSMLFT 143  Caenorhabditi...
PDM64208       52 VVNNAGGFVFAVSDVTRIRRFLILGVDGGSyysSEKEMTLDNVNalkdiihRGKADLILNEIKEIslagrNPKQDPIMIA 131  Pristionchus ...
PDM67868       57 kKNSEGYVTLALSDENRIRRFLILGATGGTfyaKEQKLTMENVQalkeiiiRGGASTILETLREVsiagkSQKQEAILLA 136  Pristionchus ...
EKC39582       38 VMNSTGGYVYSTDYVTQLMRFLCIGTTGGTyytGEAELTRENTRcidrlinSGRGKDVVELVREFsvgnrSCKQRPLLYT 117  Pacific oyster
NP_001193841  232 TPGDSESHPEPTEQVLQEVKMVLMSFLCSS---LVANVNRNDAA-------YSTQAFLLKVCSEV-----ARFEPEFVLK 296  cattle
ELV13300      121 ASLYTRQQLNIRDAAN----------------KVLAIAAFLPACRphlrryfcaivqLPSDWIQVAEf------------ 172  Chinese tree ...
XP_017203654  237 AALYTRQQLNIRVVAN----------------KVLAIAAFLPACRpylrryfcatvqLPSDWIQVAEf------------ 288  rabbit
Q231I6         87 LAVYIRNELYIRTTTN----------------YIVAFCVVHKNTQpfiekyfnkavlLPNDLLEVCEfaqvlyifdatef 150  Tetrahymena t...
WP_011727486  102 LAIAASSEDVDGRRAA--------------------LAALPRVAR------------TATHLFLFAG------------- 136  Mycolicibacte...
Q27274        143 LAICARISTHDTTKKTecpmlnay-sdyiralHDSALDLIPEVCR------------TPTHLFEFVD------------- 196  Caenorhabditi...
EGT55430      144 LAICARIATHDTSKKNrecpvidaysqyirelHAAALRLLPDVCR------------TPTHLFEFVD------------- 198  Caenorhabditi...
PDM64208      132 LALCARYRVSDLSKKAesktgqly-qeylkvmHKDAMRLVNEVCR------------IPTHLFSFVK------------- 185  Pristionchus ...
PDM67868      137 LGLCSRFGVSSLSSAPsdlaahpf-yvylremHKEATGLVNTICR------------TATHLFSYVA------------- 190  Pristionchus ...
EKC39582      118 LALCCRSNDPVTKHEG--------------------YNVLSDVCR------------IPTHLFEFIK------------- 152  Pacific oyster
NP_001193841  297 ASLYTRQQLNVRDVAN----------------KVLAIAAFLPLCRpylrryfcaivqLPSDWIQVAR------------- 347  cattle
ELV13300      173 ---Y-QALAEGDE-------------------------------------NKLVPLPACLRAAMTD--------KFAQFD 203  Chinese tree ...
XP_017203654  289 ---Y-QSLAEEAQ-------------------------------------NKLVSLPACLRAAMTD--------KFAQFD 319  rabbit
Q231I6        151 knlYlDRILSQDI-------------------------------------RKELTFRKCLQRCVRS--------KFSEFN 185  Tetrahymena t...
WP_011727486  137 ---YvEQFR---------------------------------------------GWGPTLRRAVSRwy----teRPVDAL 164  Mycolicibacte...
Q27274        197 ---YcQTISESTKag---------------------------------gaKSSTGWGRSMRNAISKwy----ttKTTEKL 236  Caenorhabditi...
EGT55430      199 ---YcQTISESTKag---------------------------------gsKSSTGWGRSMRNAISNwy----ksKTPKNL 238  Caenorhabditi...
PDM64208      186 ---FcEMVSADVKvktkeeikkekearket---gdneekmdieivndeggKKSTGWGRLMRKVIEGwy----tsRTPEQL 255  Pristionchus ...
PDM67868      191 ---YcEMVAADIIithdeevekrheepghqarkrktremlekkekesapvRKSTGWGRVMRKCIQNwy----lsKTPEEL 263  Pristionchus ...
EKC39582      153 ---CcEEESA------------------------------------------GTGWGRAHRRAIANwylnygkkGKGEFL 187  Pacific oyster
NP_001193841  348 ---FyELLCREQE-------------------------------------DCLAPLPACLRAAMRD--------KFSQFD 379  cattle
ELV13300      204 EYQLAKYNPRKHRAKRCPRRPPR--SPKTerpFSEk---hRYFSGGLQALKDEQIKFEEAYNPVSERT------------ 266  Chinese tree ...
XP_017203654  320 EYQLAKYNPRKHRAKSRPHRPPR--PPKTkpaFSEt---eRNLPFCLSFLKPEQRKFEAAYSAVKTKK------------ 382  rabbit
Q231I6        186 EYQLGKYCTESQR-KKTMFRYLS-------------------------------VTNKQKWDQTKKKRkenlltklqaik 233  Tetrahymena t...
WP_011727486  165 AYQLVKYRQRGGWSHRDMLRLAR--PSGVvdpARRmafnwAAGKGLGDYAEAparltdvelkvgqrt------------- 229  Mycolicibacte...
Q27274        237 AMLLTKYPQREGWSHRDLFRLAH--PNLMdsrSHGqsedrLEREQLFRFAVK---------GDLVKRKrkmsveevaeve 305  Caenorhabditi...
EGT55430      239 AMLLTKYPQRDGWTHRDLFRLAH--PNL----KKNdgedsYEREYLFRFAAT---------GDLKDRKrkaaadekstke 303  Caenorhabditi...
PDM64208      256 AMHLTKYGQRDGWSHKDLFRLCH--P------IAPkgdnqLVYEQIFHYAVK---------GNLNERKrrlpsdsdeaka 318  Pristionchus ...
PDM67868      264 AVAVTKYRARNGWSHKDLLRLSHpiP--------RndhqrIVFEHIFYYATK---------GECQPRKrlfpadtcwaet 326  Pristionchus ...
EKC39582      188 ALHMTKYKTRFGWNHKDVFRLCHikPev----------dhPEIKYLVMVSTKgkektdksdfvq---------------- 241  Pacific oyster
NP_001193841  380 EYQLAKYNPRKHRAKRRPRRPPR--PPEHt--FSEt---qTYLPRFIWHIRGEQRMFETTYGSVSEKK------------ 440  cattle
ELV13300      267 ----------------------------------------------------SQPKFTLKKLVQRLHIREPAQHVHALLG 294  Chinese tree ...
XP_017203654  383 ----------------------------------------------------LPPRFTLKKLVQRLRIKEPAELVQALLG 410  rabbit
Q231I6        234 esedkskretgdimnvedaikalkpavmkkiakrqnamkkhmkapkipnstlESKYLTFKDLIKFCHISEPKERVYKILG 313  Tetrahymena t...
WP_011727486  230 ------------------------------------------avrppvraevvpdeLAIIADFEDAQAASAAARWIEIIG 267  Mycolicibacte...
Q27274        306 kvwdk-------------------------------kalklpyteeqlikeeQSRALNLVEAYLKLKNEQSEEVIVAAI- 353  Caenorhabditi...
EGT55430      304 sek-----------------------------------dkndqsdvpmdteeQSSVVGLVEAYLRLKNEQNEELIVAAI- 347  Caenorhabditi...
PDM64208      319 a--------------------------------------kvkyieeqmkneeESKALVLIEKFLSLTKETPDEEVAKAI- 359  Pristionchus ...
PDM67868      327 v--------------------------------------rmkyteaqlveedISEGLLYLERVSSLSPYTSEEEMIWSI- 367  Pristionchus ...
EKC39582      242 ----------------------------------------qekqkpeyensdLKKVMVFMDAVEKAEKCRESDTMTRLI- 280  Pacific oyster
NP_001193841  441 ----------------------------------------------------TEQRFTLKKLVRRLHIHEPAQLVQALLG 468  cattle
ELV13300      295 YRYpsnlq---lfsrsRLpgpwdssragkrmklprpeTWERELSLRGNKAAVWEELIDNgKLPFMAMLRNLCNLLRVGIS 371  Chinese tree ...
XP_017203654  411 YRYpsnlq---lfsrsRLpgpwdsrragkrmklsrpeTWERELSLRGNKASVWEELIDNgKLPFMAMLRNLCNLLRVGIS 487  rabbit
Q231I6        314 KKYpkteeeykaafgdSAsapfnpelagkrmkieiskTWENELSAKGNTAEVWDNLISSnQLPYMAMLRNLSNILKAGVS 393  Tetrahymena t...
WP_011727486  268 RGH-------------GL-------------------SWEMLPDAALAQPAVWEALIDR-GMPQTALMRQLPRLTRLGVL 314  Mycolicibacte...
Q27274        354 KKH-------------GL-------------------VREHLPTTSLNSKLVWETLFDV-SMPMTAMIRNLAKMTVVGAL 400  Caenorhabditi...
EGT55430      348 KKH-------------GL-------------------VREHLPTSSLNSKLVWETLYDV-RMPMTAMIRNLAKMTVVDAL 394  Caenorhabditi...
PDM64208      360 KEI-------------GL-------------------VREHIPTEKLNSVEVWEALVQ--KMPMTAMIRNLAKMQTIGLL 405  Pristionchus ...
PDM67868      368 RHF-------------RL-------------------TWEQVPSKHLNSLEVWKAIVE--RMPMLAMIRNLAKMQNVGLF 413  Pristionchus ...
EKC39582      281 LEH-------------KL-------------------TREHVPTDLLKSKEIWKALIK--FMPMTAMIRNLGKMSQLELL 326  Pacific oyster
NP_001193841  469 CRYpsnlq---afsrsRLpgpwdssragkrmklarpeTWERELSLRGNKATVWEELIDSgKLPFMAMLRNLRNLLRVGIS 545  cattle
ELV13300      372 ARH-----HE-LILQRLQHAKSVIHSRQFPFRFLNAHdsidkfeaqlknkgxxxxxxxxxxxssdscllslsenkgdsnt 445  Chinese tree ...
XP_017203654  488 ARH-----HE-LVLQRLQHTKSVIHSRQFPFRFLNAHdsinnletqlrnralpfpsnttlmkrilirn------------ 549  rabbit
Q231I6        394 DTT-----HS-IVINKICEPKAVENSKMFPLQFFSAIeavneavtkgfkakkrenmnl---------------------- 445  Tetrahymena t...
WP_011727486  315 SGA-----VGdTVAEQLADRDRLVKARVHPVNVLVAQ------------------------------------------- 346  Mycolicibacte...
Q27274        401 DEK-----RVdNIVKRLTDQEELRRSRIHPINLLTAR------------------------------------------- 432  Caenorhabditi...
EGT55430      395 DEK-----RVdDIVKRLTNQDELRRARIHPLNLLTAR------------------------------------------- 426  Caenorhabditi...
PDM64208      406 AGE-----NVvKVANEVKDKEALKKARVHPIQLLLAK------------------------------------------- 437  Pristionchus ...
PDM67868      414 KGEkkegdKIaHVVAHLANIEAIKKARIHPIQILLAK------------------------------------------- 450  Pristionchus ...
EKC39582      327 EPGs---fEEnLTISKLTNPEMLTRARIHPFTLLVAL------------------------------------------- 360  Pacific oyster
NP_001193841  546 ARH-----HE-LVLQRLQHAKTVIHSRQFPFRFLNAHdsindleaqlekkelpfpsntqlikqiiik------------- 606  cattle
ELV13300      446 dtlsllpcslrvwagqrsgtchpgagtqdtrqnkmrvyslpdsdfpshhtalplpsntflmkrilvrysrkvkrpaikrq 525  Chinese tree ...
XP_017203654  550 ------------------------------------------------------------------arnvkrfsrqillg 563  rabbit
Q231I6        446 ------------------------------------------------------------------------------kg 447  Tetrahymena t...
WP_011727486      --------------------------------------------------------------------------------      Mycolicibacte...
Q27274            --------------------------------------------------------------------------------      Caenorhabditi...
EGT55430          --------------------------------------------------------------------------------      Caenorhabditi...
PDM64208          --------------------------------------------------------------------------------      Pristionchus ...
PDM67868          --------------------------------------------------------------------------------      Pristionchus ...
EKC39582          --------------------------------------------------------------------------------      Pacific oyster
NP_001193841  607 -------------------------------------------------------------------ntkygkkhayswq 619  cattle
ELV13300      526 lcnlnrrglrmamripVLFEQLKLEKLKiqraRQWSYDSEMldqyRQALETAVNISVKhSLPPLPG 591  Chinese tree shrew
XP_017203654  564 ihswqprllrmvmmipVMYEQLKREKLKiqkaRQWKCDAELleryRQALETAVNISVQyNLPPLPG 629  rabbit
Q231I6        448 qieavkevvektdeekkdMELEQTEEGEfv-----kvNEGIgkqyINSIELAIKIAVNkNLDEIKG 508  Tetrahymena thermophila SB210
WP_011727486  347 ----------------RTYTRGCGARGQ----AVWTPVAKI----SDALDAAFYAAYG-AVRPAyk 387  Mycolicibacterium smegmatis
Q27274        433 ----------------AVYAQGRGDKGS----LTWEPNQKI----CDALEAGFYKAFV-NAPPTGK 473  Caenorhabditis elegans
EGT55430      427 ----------------AVYAQGRGDKGS----LKWEPNQKI----VKALEDGFYKAFV-NAPPTGK 467  Caenorhabditis brenneri
PDM64208      438 ----------------TVYDQGRGEKGK----LTWEPEKEI----SAALEAAFYAAFT-NVPPTEK 478  Pristionchus pacificus
PDM67868      451 ----------------TVYDVGTGDRGS----LTWTPKPEL----SAALEKAFYLAF--SLMPKTE 490  Pristionchus pacificus
EKC39582      361 ----------------NQYKKGQGELGS----LKWQTNDNI----SKALEDAFYMSFK-NVKPTGK 401  Pacific oyster
NP_001193841  620 frqpsrrelrtammipVIYEQLKRKKMKihkaRQWKCDREMlaryRQALETAVNLSVKhSLPPLPG 685  cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap