Conserved Protein Domain Family
MRG

?
pfam05712: MRG 
MRG
This family consists of three different eukaryotic proteins (mortality factor 4 (MORF4/MRG15), male-specific lethal 3(MSL-3) and ESA1-associated factor 3(EAF3)). It is thought that the MRG family is involved in transcriptional regulation via histone acetylation. It contains 2 chromo domains and a leucine zipper motif.
Statistics
?
PSSM-Id: 399022
Aligned: 54 rows
Threshold Bit Score: 117.695
Threshold Setting Gi: 328716592
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EOQ99567             91 RGRDTe----dSSLESQKRPEIK----LVIPDELKVTLVDDWEFITKNNQLIPL-----PRTPSIQSILSSYKSHASKni 157 Wallemia...
EGT42131            100 KNRESilp-ipSSSSIEERWHWK----LDIPSGLKKIISEDQRLI-KEGRLSKI-----PSQISVEEIFNQYLESLKIdr 168 Caenorha...
CAP33940            108 TTKKS------TKRKRFPYPTVSt--nFELPPALATMLVDDYTAI-RKGFVSKI-----PAEHSIDRIITDYIKTLPA-- 171 Caenorha...
EFO83368            119 GGRSS------KKDKEDSTPYTAvpmvVHLTSPLKKILIDD-NVLNNKGYITKI-----PAKFTIDQIITDYIKTIPV-- 184 Caenorha...
XP_003094268         98 QSEESd----eSSDMESPTPGIR----FDMASPLKKIIIDDSKYL-KSDVLTHV-----PAAFSIDEIVSDYLETIPV-- 161 Caenorha...
EFP09888            487 GRRASpg---pSTSSQAQRPKIV----VDFPIWMKGIIGHDTREFLHNQTTNKLvvrlqPEGRTVDDIIKDYTDSIGV-- 557 Caenorha...
Q2M0T3              186 AKKET------VEVEKYVVQEDRv--mLRISERLREYMEYDYNMIVKLGKQHAM-----PARMPIICILENFVKQRAV-- 250 Drosophi...
WGS:AAPU:GI12047-PA 215 KDTHT------TDAEKRVHPEDRv--mLRISERLREYMEYDYNMVCKLGKEHDL-----PARMPIITILENFVKQRAV-- 279 Drosophi...
WGS:AANI:GJ13317-PB 188 KQRDKskggdkNDDEKRIHQEDRv--mLRISERLREYMEYDYNMVCKLEKQHAL-----PARTPIVTILENFVKQRAV-- 258 Drosophi...
XP_321146           155 dEYYS------SSV-ESSHEEEKv--yLQAGSKFRKHLDLDQHLIVSGTMLVEL-----PAKQPVVTILEDFVRYYTI-- 218 Anophele...
EOQ99567            158 KVAAghh--------------------------ksK-KIALI-EEVLNGLEVYFNRAIAS--NLLYRFERPQFVKVKKea 207 Wallemia...
EGT42131            169 kg------------------------------pktG-DEQLT-QHHIEMVIDYFNLYFRS--KILNKAEKCQFKELRKeq 214 Caenorha...
CAP33940            172 KNADleniddvv---------------ieydstdiR-ITNLAmICTARGVADYFNAVCGSsvQLLYHQERHQHLELIrmk 235 Caenorha...
EFO83368            185 TKDQlqnvddvv---------------leydsrdvS-NLALV--CTARALVDYFNVIIGY--HLLYKIEREQFHDLVKqk 244 Caenorha...
XP_003094268        162 TDQElqevnqvn---------------ftvtedepT-PNSVL-AISAQSLVQFFDVVLGF--HLLYPNERKQYNDLIhkv 222 Caenorha...
EFP09888            558 SDEDvermdddm---------------ldynddgtS-LDNLSlAHCAKTLKNYFNRLFGR--RILYNSEREEHDTLVRvy 619 Caenorha...
Q2M0T3              251 ELAIgikqdskrntqsr------narmereydrvmS-NVCML-KEVVDGLRIYFEFHVED--HLLYKEEKEYAYNYL--- 317 Drosophi...
WGS:AAPU:GI12047-PA 280 ELAIgikqdssrarntqs----rnarmereydrvmS-NVCML-KEVVDGLRIYFEFHLED--HLLYKEERDYVLSKL--- 348 Drosophi...
WGS:AANI:GJ13317-PB 259 ELAIgikqdssrarntl-----srnarmereydrvMsIVCML-KEVVDGLRIYFEFHLED--HLLYREEKDYALGFLTdn 330 Drosophi...
XP_321146           219 RQLFecghqeqtksrrrnssavrtehkvrdyeqirT-NVELC-KEVADGLRVYFDFTLQD--YLLYPQEKPQAQIVLA-- 292 Anophele...
EOQ99567            208 deRP---------------------------------------------------------------------------- 211 Wallemia...
EGT42131            215 rrG----------------------------------------------------------------------------- 217 Caenorha...
CAP33940            236 alem---------------------------------------------------------------------------- 239 Caenorha...
EFO83368            245 skGRnysv------------------------------------------------------------------------ 252 Caenorha...
XP_003094268        223 aide---------------------------------------------------------------------------- 226 Caenorha...
EFP09888            620 ayRKklry------------------------------------------------------------------------ 627 Caenorha...
Q2M0T3              318 --TDdnlknvsvklnssydfinpncdtelismegtqggasapgpinnygsqiingle----------------------- 372 Drosophi...
WGS:AAPU:GI12047-PA 349 --HDdismysnklaaqakeyinpsmdnelismdgsmngtnggdgtilggieyekql------------------------ 402 Drosophi...
WGS:AANI:GJ13317-PB 331 nmkncslllnksyefinpsgdnelismagnvngtngvdgpllgdi----------------------------------- 375 Drosophi...
XP_321146           293 --EDnlrsftyiasrnlsvdmlavkldsptadvnqplsehsdqqsssatsaeerrrrrlrshkneenefvldfgalqqst 370 Anophele...
EOQ99567            212 ----------------------------------------------------------------Q---NHQLKHMTSIYG 224 Wallemia...
EGT42131            218 ---------------------------------------------------------------------QSKFLPSEHYG 228 Caenorha...
CAP33940            240 ---------------------------------------------------------nlpahaaTntvVDRGFRHSQEYG 262 Caenorha...
EFO83368            253 -------------------------------------------------------------gtvAt-mPDNGFRASSEYG 270 Caenorha...
XP_003094268        227 ---------------------------------------------------------glvllnpNnlpAPAGFKSSEHYG 249 Caenorha...
EFP09888            628 ------------------------------------------------------------gdvvTd-pFQYGFHASKRYG 646 Caenorha...
Q2M0T3              373 -----------yekqfqrcllyiakssgkntansydprtcpytaadklpmemrgflretfkwrlLsaeSM--PEKSMVFG 439 Drosophi...
WGS:AAPU:GI12047-PA 403 ------------qkcllyivkcsgknnmahaydqrtspytaayklpmemrgflcetfswsllakTdtlYLDRSEKSMIFG 470 Drosophi...
WGS:AANI:GJ13317-PB 376 ------------------eyenqlqkclryieknsaknnialaytaayklpmemrgflretfswSllsEESPPEKSIIFG 437 Drosophi...
XP_321146           371 aqqqqqqqqqqqgqhiqsslaveyggdlspfgsslnilrsiipqnvtisreakevlddvfrwriLpsnAP--AEPSMIYG 448 Anophele...
EOQ99567            225 VEHLLRLIVNLPSMLAYTSIDAESATILHETVQNLLDWIIDNKKQLFL--PEYEN 277 Wallemia ichthyophaga EXF-994
EGT42131            229 LIHLARSFAVIPDALELKLEDEKHFKNITPVVHNFMEWLDNNKEMFYNkvRSYLK 283 Caenorhabditis brenneri
CAP33940            263 IIHLVRLLSKLPELLAHTDWEHRILSRIMTGIRDLVGFLDKNRSHYHKgaEMYES 317 Caenorhabditis briggsae
EFO83368            271 FIHLLRMMAKLPDLLKLTQWNAHLCNRIMIGVHDFVVFLNKNHAQYYGdrDDYET 325 Caenorhabditis remanei
XP_003094268        250 LIHFLRMFTKLPKLLEESGLNQNVINRLTIGIESLLDFLERNFEKYYNngVDYDS 304 Caenorhabditis remanei
EFP09888            647 IVHFARMLSRFDNLIESLRLHDAMILYLNLGIKDLMEFLGNNVGRYYDrdADYVP 701 Caenorhabditis remanei
Q2M0T3              440 APHLARLMIKVPEYLNISPISNQKLEDLLPHLDSFINYLEN-HKEWFDk-ENYVH 492 Drosophila pseudoobscura
WGS:AAPU:GI12047-PA 471 APHLARMLVLLPAWLNESPISNEKLEILIPHLNSLINYLEN-HKEWFDk-QNYCK 523 Drosophila mojavensis
WGS:AANI:GJ13317-PB 438 APHLARMLVLLPECLNASPISNEKLVDLLPHLDSFINYLEN-HKEWFDk-QNYVD 490 Drosophila virilis
XP_321146           449 AVHLARLIVKLPEFLSATAMADEKLKLLLKFLDIFAEFIEE-HEEWFGk-QFYFS 501 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap