Conserved Protein Domain Family
Sipho_tail

?
pfam05709: Sipho_tail 
Phage tail protein
This family consists of several Siphovirus and other phage tail component proteins as well as some bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399020
Aligned: 40 rows
Threshold Bit Score: 92.0649
Threshold Setting Gi: 122539075
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EQC80926        21 DRGLLPGIEYNTKKVGRSDGEKYVDRSIGRKTIPMGFKL---------RYDLIKKRRALAEILAQKDp-KPLIFSDEPDK 90  Enterococcus ...
WP_000059860    22 QHPAAPPVRDYTVSIPGRPGAYYFGSDIDPMEFNLPLIIkpqenryelAAAIRKMVDTFIDPYGKPKe-VKLIYDYEPDK 100 Bacillus anth...
WP_013779717    22 SIRSLPNLRENEITIPGKHGIYDAGTEFGTNTITLDLGVve-----rnVSTVYSKIREFANYISPLVgyRELIFEDEPSL 96  Mahella austr...
jgi:Mahau_2901  22 TIRSLPNLRENEITVPGKHGIYDAGTELGANTITLDLRVfe-----idVSTVYSKIRAFANYIGPLNgyRELTFDDEPNL 96  Mahella austr...
Q9K756          19 GRPILAPRHLSTKEIYGRPGAFFFEKRDGPILLPVEVTLhe-----kdHQSYRSLVRELAVYLDTEEp-VPMIFSDEPDK 92  Bacillus halo...
Q9KGP4          19 KRPLLPPQELSTMSIYGRHGDFFFRKQHGAVTLVVSVTIrd-----qtVDGYRNRIRELAGHLNKSEp-KPLIFKDEPDK 92  Bacillus halo...
WP_011878905    22 NRPILSGVNDSYLQIPGRHGTYLFGGELADRTIDLECAIla-----gsLPDLRSKFREISSWLYSPKr-ENLVFDDELDK 95  Desulfotomacu...
jgi:Bcell_2107  19 KRPIMPPQQFATINIANRPGVIVGNEKDAAFAIEVGVIVke-----ksLDLLRKRIRMIASKLKGKG---KLIFSDEPD- 89  Bacillus cell...
WP_013494480    24 RRSILPPVTARTLDTPGRPGVYYQGFDYGAREIQVDIILae-----stLESLRSRVRNLAAWLRPDDtpRPLVFDDEPEL 98  Thermaerobact...
BAM46355        18 NRPPWMPIHRELVTVVGKPGAYLSNTQKQIRTINVPVLLla-----ddLSDLQKVKEDLANWLIHDEp-KELIFNDEPDR 91  Amphibacillus...
EQC80926        91 CWYAISTGDISVAENNFL----GSGEINWIVPD-GVSYdvnprifsnisidsaenqvldpefrkkdkyyKQWTARLnETN 165 Enterococcus ...
WP_000059860   101 YYLARYSGSMSIERYFRM----GKFELPMIAYD-PYAY-------------------------------SIIDSTNgIKW 144 Bacillus anth...
WP_013779717    97 VRYVKVSEGAEIDMMYNAikniGKFSITFKMAD-PFVY---------------------------------------KAD 136 Mahella austr...
jgi:Mahau_2901  97 VRYVKASEGAEIDVLYSSpkktGQFSVTFKMAD-PFVY---------------------------------------KTD 136 Mahella austr...
Q9K756          93 FIEGILADESVLDEIATV----GQGEIQFFCPD-PYWY-------------------------------AIEDDVMsWNG 136 Bacillus halo...
Q9KGP4          93 FVRALMTDESDLEELVMM----GQGELSFYCPD-PYFY-------------------------------AIEDEVFtFSG 136 Bacillus halo...
WP_011878905    96 YYLAKLDGQIDVEQARAT----GKFDLKFRCEPlAYGG-------------------------------DIENLFI---- 136 Desulfotomacu...
jgi:Bcell_2107  90 IYYNVIVQDTDLEEILSI----GQGTILFFAHD-PYAYgqei-----------------------qegvSVYPTTVfLTP 141 Bacillus cell...
WP_013494480    99 TWYAVLSGDTNLEEIVTV----GRGTLTFLCPE-PYAI-------------------------------GPERVLTi--- 139 Thermaerobact...
BAM46355        92 VYYAVVSGSLDLDELVYS----GQGIITFLCPD-PFKY-------------------------------GHEKTIHfP-- 133 Amphibacillus...
EQC80926       166 gahnilgadlsdtntiadkgevkyngfyimqnsnstarnlselkqgdkvwgrvalridkalqgdtngsksavaviqeldy 245 Enterococcus ...
WP_000059860   145 gdpipwmsdipi-------------------------------------------------------------------- 156 Bacillus anth...
WP_013779717   137 wyiee--------------------------------------------------------------------------- 141 Mahella austr...
jgi:Mahau_2901 137 whiee--------------------------------------------------------------------------- 141 Mahella austr...
Q9K756             --------------------------------------------------------------------------------     Bacillus halo...
Q9KGP4             --------------------------------------------------------------------------------     Bacillus halo...
WP_011878905       --------------------------------------------------------------------------------     Desulfotomacu...
jgi:Bcell_2107 142 fmis---------------------------------------------------------------------------- 145 Bacillus cell...
WP_013494480       --------------------------------------------------------------------------------     Thermaerobact...
BAM46355           --------------------------------------------------------------------------------     Amphibacillus...
EQC80926       246 aggkvlasheakpaalnlgnfqnldihftisnpntkalnlitclalgsavsyskpqfnlgekladfaeptaqlADYVAVT 325 Enterococcus ...
WP_000059860   157 --------------------------------------------------------------sagdnsytinsPQNISLN 174 Bacillus anth...
WP_013779717   142 --------------------------------------------------------------------wdalhGGSTIIV 153 Mahella austr...
jgi:Mahau_2901 142 --------------------------------------------------------------------wdapyGGSTTIV 153 Mahella austr...
Q9K756         137 -------------------------------------------------------------------------PGTYTLD 143 Bacillus halo...
Q9KGP4         137 -------------------------------------------------------------------------AGSYDFS 143 Bacillus halo...
WP_011878905   137 -------------------------------------------------------------------------NDQVTVF 143 Desulfotomacu...
jgi:Bcell_2107 146 ----------------------------------------------------------------------eyeTSSSLIL 155 Bacillus cell...
WP_013494480   140 -------------------------------------------------------------------------ADGATVT 146 Thermaerobact...
BAM46355       134 -------------------------------------------------------------------------SDQVIVE 140 Amphibacillus...
EQC80926       326 N-HGTYKAWPILRA----------------TMNGENGLVGVVN-----PDDGILQFGNAeeldviegqrtdkvisipmrn 383 Enterococcus ...
WP_000059860   175 N-YGTLVVRPVINI------------------SGSAENLTLTL------KGERFSLG----------------------- 206 Bacillus anth...
WP_013779717   154 N-NGGIECPVILKIyvpantiatqpatglgTTNSGTTGGASVTgvaisINGQTVKYKGE--------------------- 211 Mahella austr...
jgi:Mahau_2901 154 N-NGGIECPVILKIyapantiatqpatglgTTNSGTTGSASVTgvtisINGRTVKYKGE--------------------- 211 Mahella austr...
Q9K756         144 R-KGTAVSYPKIEI----------------QGSNVGGSIQLVT------DNADITFTGE--------------------- 179 Bacillus halo...
Q9KGP4         144 ReKGTTESFPLIEI------------------RGEIGSTGEVTi---eTDDTRLTFNGL--------------------- 181 Bacillus halo...
WP_011878905   144 N-QGTYEALPLFQS----------------TFIQPATEWRVNK------ATEYIRVVRG--------------------- 179 Desulfotomacu...
jgi:Bcell_2107 156 N-GGTVEADQIFEV----------------TFHQSVNEFRITHq----EQGKYIRLMHG--------------------- 193 Bacillus cell...
WP_013494480   147 A-QGTADTYPIIRA----------------TVQRDITFLSIGT------VDRYVLLGTPseveqasvppyerimsdeltt 203 Thermaerobact...
BAM46355       141 N-NGTAEADPIFEL----------------TATKKSTFAMISN------GEDYNLIGQPsdvdveqvdseeilinerget 197 Amphibacillus...
EQC80926       384 naskfelnspkakpdypnyggnpdtpnkiggdvdwttradvvmpiwpenhdgvwagptlytdipkntsnldtgnftyrsr 463 Enterococcus ...
WP_000059860       --------------------------------------------------------------------------------     Bacillus anth...
WP_013779717       --------------------------------------------------------------------------------     Mahella austr...
jgi:Mahau_2901     --------------------------------------------------------------------------------     Mahella austr...
Q9K756             --------------------------------------------------------------------------------     Bacillus halo...
Q9KGP4             --------------------------------------------------------------------------------     Bacillus halo...
WP_011878905       --------------------------------------------------------------------------------     Desulfotomacu...
jgi:Bcell_2107     --------------------------------------------------------------------------------     Bacillus cell...
WP_013494480   204 tegwvdgldadgglvagtmtsngnefvvadygigsgwhgpalqkglpelvqdfrvtmwvqaingkaevgrveaylldqtg 283 Thermaerobact...
BAM46355       198 lsewntppikidshtavidgsmgtdgtgivplnygsgdawhgparaieinpiqdfevemkcrveltrpsdtfrietylfd 277 Amphibacillus...
EQC80926       464 fdfeptkttsgrltftlqnsslgsivscvirdssrvreelivefscfdkvqkrltldrkewtgrfweiqiqrtsdttvew 543 Enterococcus ...
WP_000059860       --------------------------------------------------------------------------------     Bacillus anth...
WP_013779717       --------------------------------------------------------------------------------     Mahella austr...
jgi:Mahau_2901     --------------------------------------------------------------------------------     Mahella austr...
Q9K756             --------------------------------------------------------------------------------     Bacillus halo...
Q9KGP4             --------------------------------------------------------------------------------     Bacillus halo...
WP_011878905       --------------------------------------------------------------------------------     Desulfotomacu...
jgi:Bcell_2107     --------------------------------------------------------------------------------     Bacillus cell...
WP_013494480   284 aiigkigladkyagrd------------------------emwgiaragnlangtyiineygdrrgvwndfygvlrigrv 339 Thermaerobact...
BAM46355       278 enlnvigkiaivdstvngs------------------qvaaegrsgdwvgnnvnyeissknylrrtnhfhgvvkvtrkgk 339 Amphibacillus...
EQC80926       544 kfskwkafsgegiiaskaevfsatlpeisgvgidglctwfqkwgddptnehalymtwtdckfywdnettitnipnlFDDG 623 Enterococcus ...
WP_000059860   207 ----------------------------------------------------------------------------TFTN 210 Bacillus anth...
WP_013779717   212 ----------------------------------------------------------------------------IEEG 215 Mahella austr...
jgi:Mahau_2901 212 ----------------------------------------------------------------------------IEEG 215 Mahella austr...
Q9K756         180 ----------------------------------------------------------------------------LAVG 183 Bacillus halo...
Q9KGP4         182 ----------------------------------------------------------------------------LSRG 185 Bacillus halo...
WP_011878905   180 ----------------------------------------------------------------------------FAPG 183 Desulfotomacu...
jgi:Bcell_2107 194 ----------------------------------------------------------------------------FNVG 197 Bacillus cell...
WP_013494480   340 gntweayiakydpvkrvyhtrrlrrwtdtkgrwtaplarvqlhagaygenppmsvrilsvtvervnklqlsdvpiiAGPG 419 Thermaerobact...
BAM46355       340 elifyaarlgsgdnpihhdtltvsrfitdsnllgrlkyiqihfgkygqstnatvprinqlkvtelkevsvdktpyiIYPN 419 Amphibacillus...
EQC80926       624 DVLEID-VLNRKVFL-----NGFENFKLHALGNTWE-RFAVEPGTTTFLpvASSWTNIFDFEVELRGAYI 686 Enterococcus sp. HSIEG1
WP_000059860   211 STFLLDaKHYTAIK--------NGQNYLFQLKGDLE-KLELIPGANVIK--ISGVNLNINITFEYRAKYI 269 Bacillus anthracis
WP_013779717   216 DEVIID-TGNFTVTM-------NGQNAMQYWEGE---FPQLQAGENIITe-HDDSGVGAKVVFQFRERWL 273 Mahella australiensis
jgi:Mahau_2901 216 DEVIID-TGNFTVTM-------NGQNAMQYWEGE---FPQLRAGENEVAe-TDDSGVGAKVIFQFRERWL 273 Mahella australiensis 5...
Q9K756         184 ETLVLD---SKFVTAyiiktDGTQESALNDIDNID--MPVLVPSANRLSisVEGNATVSTFKVTARSCWK 248 Bacillus halodurans
Q9KGP4         186 DILTLD---SHYLTAyiqkpDGSQVSAINELDRMD--FPVLKTGVNHMAirATGEADVHEVQMMSRSRWL 250 Bacillus halodurans
WP_011878905   184 DVLEVN-CATGAILL-------NSVRILESLDWQNSiFFAFPPGEHTLN---IAPAGVCNTKIIYKPRWL 242 Desulfotomaculum reducens
jgi:Bcell_2107 198 DVLVID-CKNEVIRV-------NGTRINNKLTFDSD-YFKLQIGENTLT---VSPSVSNDTVIRYEPRYL 255 Bacillus cellulosilytic...
WP_013494480   420 DEIEID-CERFAVRL-------NGEHALELLDPSSQ-FFVLRPGEPVTF--DVSPPGAATVELRYRERWL 478 Thermaerobacter mariane...
BAM46355       420 DVITFD-HKNEDILV-------NGEPRKDLKNFGAS-FFTLKKGDNQLL---VTPEDSFETNVRFRERFy 477 Amphibacillus xylanus N...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap