Conserved Protein Domain Family
WEMBL

?
pfam05701: WEMBL 
Weak chloroplast movement under blue light
WEMBL consists of several plant proteins required for the chloroplast avoidance response under high intensity blue light. This avoidance response consists in the relocation of chloroplasts on the anticlinal side of exposed cells. Acts in association with PMI2 to maintain the velocity of chloroplast photo-relocation movement via the regulation of cp-actin filaments. Thus several member-sequences are described as "myosin heavy chain-like".
Statistics
?
PSSM-Id: 399015
Aligned: 27 rows
Threshold Bit Score: 429.435
Threshold Setting Gi: 944088713
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KRH15354            351 RGLIDTAAPFESVKQAVSKFGGIVDWKAHRVQTVERRKHVEHELDLVQQEIPECRKKSVVAEQAKTQVLQELDSTKRLIE 430  soybean
XP_006661311        143 RVLVDTRAPIESVKDAVSKFGGILDWK-------ERRKHVQIELDKMQQDATEYQIKIEATRVQKSKVLEELRGTRRIIE 215  malo sina
WGS:AAAA:OsI_31651  195 RVLVDTAAPIESVKDAVSKFGGILDWK-------ERRKHVQVELDKMQEDAPEYKRRVEVTEVEKSKVLEELYCTRRTIE 267  long-gr...
XP_006650963         31 KVHIDTTAPIDSVKGAVSKFGGILDWR-------ERRKQVQDELDKVQEEVADYQKRSQEAAAGMARAAQELGGANGAID 103  malo sina
XP_004986035         55 idhVDTAAPIDSVKGAVSKFGGILDWK-------EKRKQAQDELDKVQEEVTEYHKRSTAAEAGRAQALQELGSTTRAAD 127  foxtail...
BAJ89194            150 AHRVDTAAPIDSVRGAVSKFGGILDWR-------ERRQQVEEELGGVQAEAAEYQRRTREADAGRAEAQQDLMGATGEID 222  domesti...
XP_025882671        223 KGLIDTAAPFESVREAVTKFGGIVDWKAHKAQMMERRKFIQLELEKVQKEIPLYKEELEAAEMVKSQVVNELEDTRRIIE 302  Japanes...
XP_002465169        142 TGLVDTSAPFESVKEAVTKFGGIVDWKAYRAQSLERRRVMQLELEKVQQEIPQCKEDWETAEVAKSHVIEELERTNRLVD 221  sorghum
XP_015691130        132 RALVDTAAPFESVREAVTKFGGIVDWKAYRSQTLERHRVMQLELDKAQQEIPQFKQDSEAAEMAKLQVVEELERTRRLVE 211  malo sina
BAJ98967            144 KGLVDTAAPFESVKEAVTKFGGIVDWKAYRTHTLERRGAMQLELEKVKQDIPQVKESSETAEMARSQVVEELEITKRIVE 223  domesti...
KRH15354            431 ELKLNLERAQTEERQARQDSELAKLRVEEMEQGIADDSSIAARAQLEVAKARYTSAITELTSVKEELEGLRGEYAALDVE 510  soybean
XP_006661311        216 GLRIDLDNAQVEAMQAQQNLELVEIQFKEIQQGIAHKENGILKEEIGLVDERRASVLTDLQSVKMELDQLQKEYTSLVSQ 295  malo sina
WGS:AAAA:OsI_31651  268 RLKIDLDKSHTEAIQAQQDLELAEIRFEEMQQGIARKERSITKAKIEVANERRATALEDLQSVKMELDQLQKEYTSLISQ 347  long-gr...
XP_006650963        104 ELRLSLEKAQAEEARARQDTELAELRLRETQQGV--RESTAAKAELAVARDRHATAIADLRSVKAELELLRKEHAAAAAE 181  malo sina
XP_004986035        128 KLRLSLKKAQIEDAQARQESELAEGRLRELQRNA--SERAAAKAELDAARDRRSAALADLQAARAEVGSLEKVRAAAAAE 205  foxtail...
BAJ89194            223 DLWLTVKRAQIAEAQARKDSELAKLRLRKLEKGA--RERAAAKAELESLRDRHAAALADLRATRAELGTLKKERDAVAEE 300  domesti...
XP_025882671        303 ELKHNLEKAQVEEVQAKQDSELALLRAQEIEQGVADEASVIAKTQIEVAKERHEKAIAELNSVKEELKTVHEQYVTLINE 382  Japanes...
XP_002465169        222 ELKHTLERAQLEVDQAKQDSELALLRAQEMEQGIDDEASVIAQTQLAVAKERHEKAVEELKLLKQELRSTQEQYAVLATE 301  sorghum
XP_015691130        212 ELKHKLERAEIDMDQAKQDSELAQLRAQEMEQGIDDEASVIAQTQMTVAKERHQKAVEELKLVKDEMESTHERHTVLASE 291  malo sina
BAJ98967            224 ELKHKLERAQVELEQSKQDSELAQLRAQEMELGIDNEASVIAQTQLAVAKERNQKAIDELKMVKEGLGLTQEQYTTLVSE 303  domesti...
KRH15354            511 KDEAIKRAEGAVASSKQVEKTVEDLTIELIATKEALEIAHTAHMEAEEHRIGTVMARDQDYLNWEEELKQAEEEIQSLNQ 590  soybean
XP_006661311        296 RDITEKKACESFVASQEIEKIVEDLTIKIINMKESLASFQAAHIIAEEQKRNVALTYQHDRLNWHNELNQLDDEVQKLND 375  malo sina
WGS:AAAA:OsI_31651  348 RDNTETKAREAIVASQEIEKVVQDLTIKVITMKDLITTSQANHVIAEGKKINAALAYQQDMVNWQNELKQIDDEVQKLND 427  long-gr...
XP_006650963        182 ADAAAARARVTVSSSQEAVKAVEELTAELVAVKEEVEACHLAHDEAEEKRMRVAMALEQEKVQWRRELELAEQEVKKLAD 261  malo sina
XP_004986035        206 ADTATARAREAAAESRESGKAVEDLAAELIELKAELESSHAAHVDAEEKRLRLALALEQDKSQWQIELEDAQQEAKRLRD 285  foxtail...
BAJ89194            301 ASAAAARVRVTAGEAVQVGEALREATAELDVLMAELESARATHDTAEERRMRLALAWREDKLRWQNELEQGEMEVRRLRD 380  domesti...
XP_025882671        383 RDTAIKRSEEVISVGKDIEKRVEELTLELIASKGSLELAHAAHHEAEERRIGAALEKEEDCVAWDRELQQAQEELQQLNN 462  Japanes...
XP_002465169        302 RDVAIKRAKEVVCAAKDTEKQVEELTLELIASKESLELAHTSHHEAEEHRLGAALAKEQDFLAWEKELQEAQEELNQLNE 381  sorghum
XP_015691130        292 RDIAAKRAEEAVSAAKETEKRVEELTLELIAIKESLESAHAAHHEAEEHRLGAALAKEQDCLSWEKELQQAQEELQQLNM 371  malo sina
BAJ98967            304 KDATIQRAEEAASAAKETEKRVEELTLELFASRESLELAHAAHHEAEEHRLGAALAKEQDCLAWERELQQAKEELRQLDE 383  domesti...
KRH15354            591 KILSAKDLKSKLNMASALLLDLKAELNAYME-SIPNHEGdkDGVSkgelekpeKKTPNEIQEAVASAKKELEEVKLNIEK 669  soybean
XP_006661311        376 DLSVNKDLESKLQAASVLLMNLRDEFMAYVE-GTLPEVPsdNKEK--------ECPMVLLRMKLAQTRKELEDMRIDIGR 446  malo sina
WGS:AAAA:OsI_31651  428 DLSLNKDLESKLQTASMWLMNLRDEFKAHVD-GTLPKVPseAREE--------ERPMIIVCAKLARTRKELENMRIDIDK 498  long-gr...
XP_006650963        262 SLMATKDLESKVAAASETLVGLRAELFARAVeGTIGEEAatEK----------EKPTVSSRAKLDKTKKELEDVKATVDK 331  malo sina
XP_004986035        286 ELMAACDVEMKAEAASELLANLKAELFACAVeWTLGED---------------EKPTVSSQPMLEKVKKELEDVKASVER 350  foxtail...
BAJ89194            381 ELVAAGELESKVAAASEHLANLRAELFARAVeGASEEEDk------------qTPTARSTPVMLDSAKKELEEVKGNVEK 448  domesti...
XP_025882671        463 KLLSKSDVKQNLDTNLRRLRSLKSELATYVQ-NVISEEAegLVKEhgp--ddaQQISGPVKEALASAQKELEEVRANIEK 539  Japanes...
XP_002465169        382 QIASKTNMESEADENERKLLSLKSALAAYVE-NKLNEEAg-MVQEqgs--deaKEISRSIKEALASKRKELAEFKGKLEN 457  sorghum
XP_015691130        372 QLVSKTDVQSKLDENMRMLQSLGTELAAYMG-NKLNEEAg-VVEDdgs--deaKEISRSIKRALASIRRELEGVRGNIEK 447  malo sina
BAJ98967            384 QILSKTSVQSKLDGNKDNLLRLSADLAAYMA-NKLSEEAg-AVEEhggs-dedREMSRSIKQALASARMELEDVRGNITK 460  domesti...
KRH15354            670 ATTEVNYLKVAAASLKSELENEKSSFASIRQ-REGMASITVASLEAELDSTRSEMVLVQ-MKEKEGREK-IAELPKKLQQ 746  soybean
XP_006661311        447 AKNEVKSLWNVAATLRADVENEKTNLAVLRQ-KENLAFVSALSLQEELNKIAFDLSTVE-ERTKA------AKIPLELQQ 518  malo sina
WGS:AAAA:OsI_31651  499 AKDDVKSLWNAAATLRANVEMEKTNIASLRQ-KENLAFESALALQEELSKIAFELSMVE-ERTKA------AKMPLELQQ 570  long-gr...
XP_006650963        332 AKDEAKCLRVAAASLSADLEKQKAELAALRR-REGLSATSIPALEEELSRVTTGLTAAQvARAKDGGVE--TKMPAQLEE 408  malo sina
XP_004986035        351 AKDEAKCLRVAAASMRDDLDKEKAELAALRR-REGLSSASIPYLKEELSRVTSELAVAE-AAAKADNGE--SRMAEEVGE 426  foxtail...
BAJ89194            449 AKDEAKILHVAAASLRADLEREKAELDSLRRkQSTSSSASISSLEEELRRVTTELAAAQ-ARARDSGEEkKKTTPEQLDE 527  domesti...
XP_025882671        540 AKNEAKLFKLAATTLRSEMDNEKSSLVELQQ-REGMASIAICALEAELNRTKQEIEYVK-SKEEDAQER-MVELPRILQE 616  Japanes...
XP_002465169        458 ARNEANLVRVIAESLCSELDREKALLATLQQ-SEGMASITVSSLEAELNRTKQEIEMVH-KKEAETREK-MAELPRMLQQ 534  sorghum
XP_015691130        448 AKDETNLIRAIAESLRSELDKEKASLVTLHQ-QEGMASITVSSLEADLNRTKEDIEMVH-KKEVETREK-MVELPKILQQ 524  malo sina
BAJ98967            461 AHEEANLIQAVAESLRTELDKEKASLVTLQQ-RESMASITVSSLEAELSRTKQEIEMLY-TKEAESRAK-MADIPKMLQR 537  domesti...
KRH15354            747 AVEEANQANLLAQAAREELRRIKEEAEQAKAGASTMQSKLLAAQKEIEAARASERLAIAATKALQ--ESEsSSRNNNELD 824  soybean
XP_006661311        519 ASKKLEHAKKNVMFARNEMKKAREEADQAQAEINVVQLRIEATSREILAVNASREIAVASANALE--DYKdEVELESQVA 596  malo sina
WGS:AAAA:OsI_31651  571 ATKKLEHAKLNAVFARNEMEKAREEADQAQAEVNVVQLRIEATLREILAVNASREIAVASANALQ--DYKqEIELEPLAN 648  long-gr...
XP_006650963        409 ARREAEKAKAKARSAQEAVSKAREEAVLAKAAVHTMEARLEAVKREILAATTSEGIAAASAAALLq-EGKpARNAQLQED 487  malo sina
XP_004986035        427 ARREAEEAKAKARSAREEVAKAREEAGVAKAAVATVEARLEAVAREILAATTSEEIATASAGALLqaESKpSKRSQSKPI 506  foxtail...
BAJ89194            528 ARREAEQAKASARATQEEVAAAREDARVARAAVQATEARLEAVMREMLAAKASAETAAASADALLq-QQDtTRSAQSQGG 606  domesti...
XP_025882671        617 AAQEAEDAKMVAFSVQEQVRKAREETEKTKTAAATVNTRLSAVLKEIDASKASKKLAFAAVQALQ--ESE---EAGDDEN 691  Japanes...
XP_002465169        535 AAQEAEDAKVAAHSAQEELRKAKEEAEQTNASVTTADTRLHAVLKEIEASKESERLAIVAAQAMQ--ESK---ETGSIGA 609  sorghum
XP_015691130        525 AAQEADDAKVAAHSAQEELRKAKEDAEQTKAAAATVETRLHAVLKEIEASKASEKLALVAAQALQ--ESE---ETSSVED 599  malo sina
BAJ98967            538 AAQEADDAKVAAHSAREELRKSKEEAEQAKAAATTAEVRLRAALKEIEASKASERLALVAAQALQ--ESE---EATGAED 612  domesti...
KRH15354            825 SSSW--VTLSVEEYYNLSKQAHDAEQQANMRVAAANSEIEIAKESELKTLEKLNDVNREMAARRESLKIAMDKAEKAREG 902  soybean
XP_006661311        597 RRNKt-ITLSIEEYNILCKKVQDAEDLAKKRVIRAVDKIKEAKEAEVRSLDRLDQLIKQIDDRRIALRDAHEKANVAHDG 675  malo sina
WGS:AAAA:OsI_31651  649 RKNNn-VTLSLEEYNVLCKKVQDAEDFAKKQVIRAIEKIKEAKDAEVRSLDRLDQLIKQIDDRRVALREAHEKANVAYDG 727  long-gr...
XP_006650963        488 VEGS--VTLTAEEYDELSRRARETEEDAGKRVTEAVKQIKEAKDAEVRSLDKLAQLAKQTEQRRQALEAASAEAEEAEFG 565  malo sina
XP_004986035        507 VEGG--VTLTVEEYDELSRRAREMEEIAGKRVMEAVKLIKEAKDAEVRSLEKLAKQDRQTEQRRQALEAATLEAEEAEFE 584  foxtail...
BAJ89194            607 AVPEdcVALTTEEYEELSRRARETEEAAGERVDEAVMHIKEAKDAETRCQERLAQLERETEQRRQALRAATEEAEQAESG 686  domesti...
XP_025882671        692 SPRG--VTLPLSEYYTLSKKVHEAEQLAHESVTEALAQVESAKASESNSLERLCEASKRMNEKKEALERALERAERANQG 769  Japanes...
XP_002465169        610 SPRG--VTLPISEYHALSKRVHEAEEHANERVAAALAQIEVAKESESRNLERLQEAFRDMDEKKSDLQIALERAERANEG 687  sorghum
XP_015691130        600 SPRT--ITLPISEYHSLSKRVYEAEELANERVVVALTQIELAKESETRTLERVHEAAKEMHQKKDALEIALERAERAKEG 677  malo sina
BAJ98967            613 SPR---VTLPVGEYHLLSKRVHEAEELANERVMASLAQIKVAKESESRSLERLLEVSRSMDQKKDALKIASQRAAMAEEG 689  domesti...
KRH15354            903 KLGVEQELRKWRAEHEqQR 921  soybean
XP_006661311        676 KLAMENELRKRRAQHE-KQ 693  malo sina
WGS:AAAA:OsI_31651  728 KLAMENELRKRRAHHE-KQ 745  long-grained rice
XP_006650963        566 KLAAERELRQWRAEHEhQR 584  malo sina
XP_004986035        585 KLSAERELRQWRAEHDpQW 603  foxtail millet
BAJ89194            687 KLAAERELRQLQAEQHrra 705  domesticated barley
XP_025882671        770 KLTAEQELRKWRADHE-QR 787  Japanese rice
XP_002465169        688 KLGAEQELRRWRAEHV-QR 705  sorghum
XP_015691130        678 KLGAEQELRKWRAELE-QR 695  malo sina
BAJ98967            690 KLGAEAQLRKWRSEHK-QL 707  domesticated barley
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap