Conserved Protein Domain Family
SBP56

?
pfam05694: SBP56 
56kDa selenium binding protein (SBP56)
This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea. The exact function of this protein is unknown although it is thought that SBP56 participates in late stages of intra-Golgi protein transport. The Lotus japonicus homolog of SBP56, LjSBP is thought to have more than one physiological role and can be implicated in controlling the oxidation/reduction status of target proteins, in vesicular Golgi transport.
Statistics
?
PSSM-Id: 399010
Aligned: 21 rows
Threshold Bit Score: 725.25
Threshold Setting Gi: 500047428
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9VFZ4              6 CCRGPG-YATPLDAMrSGPREKLLYTVTVQPNLDEPHGDYLSTVDVDPESPTYCQIVHRTFTNRKGDELHHSGWNACSS- 83  fruit fly
Q8ZUL2              4 LKPDPTfYPTPRDAM-RAPPEDIAYVAALYVGTGVNAPDFLAVVDVDPKSPTYGKVIYKLDLPYIGDELHHFGWNACSSa 82  Pyrobaculu...
WP_012020924        7 FRRDPTfYPSPRMAM-NSPPEDLAYVASLYTGTGINRPDFLAVVDVNPKSETYSRIVGKVEMPNLNDELHHFGWNACSSs 85  Metallosph...
Q4JBV8             10 FKRDPTfYPSPKMAI-NSPPEDLAYVACLYVGTKINRPDYIAVVDVNPKSETYTKVVAKVELPYTGDELHHFGWNACSSs 88  Sulfolobus...
Q1AZ66              4 WRPDPTfYPSPKMAM-QAPRERLGYVALLDPGRE--RPDALGVLDLDPDSGTYAQIVGRVEMPNAADELHHFGWNACSAa 80  Rubrobacte...
jgi:Franean1_5378 108 SNPDPTfYRSPGDAA-AAPPEQLAYVAAFDPKGA--VSDAMTVVDVDSTSSSYGRIVGWTDLSGRDDELHHFGWNACSSa 184 Frankia sp...
WP_012403483        4 WKPDPTfYPSPRMAG-SAPKETVAYVASFDPSRE--SPDELAVVDVDPSSADYGRIVSRVPMPNTGDELHHFGWNACSSc 80  Paraburkho...
Q01W20              3 WQPDPTfYPSPKMAM-EAPAEKLAYVAMLNPNVK-KGPDAMAVIDVDAESKSYGHMVGRADMPNAGDELHHFGWNACSSc 80  Candidatus...
XP_021131062        4 cgacgpgyatpldaM-KGPREEILYLPCIYRNTGIEKPDYLATVDVDPKSPHYCQVIHRLPMPNLKDELHHSGWNACSS- 81  mallard
CAF90090            2 sgCGPG-YRSPLEAMk-GPREKIVYLPCIYRNTGTLKPDYLATVDVEPTSPTYCKVVHRLPMPNLGDELHHSGWNACSS- 78  spotted gr...
Q9VFZ4             84 -CYyvDESSKtvpKRDRLVLPSLNSDFIYILDVVTDPRKPEIVKTIDG-DVLKSHNVTAPHTTHCLANGNIMISVMGDAE 161 fruit fly
Q8ZUL2             83 yCPn-AKPFL---ERRYLIVPALRSSRIYIVDTKPDKRRPAVAKIVEPeVAVGRTGYTKYHTVHCGPDA-IYISALGGPD 157 Pyrobaculu...
WP_012020924       86 lCPn-GRTDL---ERRFLIVPGLRSSRIHVIDTKDNPRQPKIVKVVEPsEVSKVTGYTRLHTVHCGPDG-IYISAFGNEI 160 Metallosph...
Q4JBV8             89 lCPn-GRPNV---ERRFLVVPGLRSSRIYIIDTKLDPRKPNIVKVIQPeEIKKVTGYSRLHTVHCGPDA-IYISALGNEV 163 Sulfolobus...
Q1AZ66             81 lCPyaPHPHV---ERRYLIVPGIRSSRIHIVDTKPDPREPRIVKVIEPeELHRRTGYSRPHTIHCGPDG-VYVSALGSPE 156 Rubrobacte...
jgi:Franean1_5378 185 lCHg-HHGHAanlERRYLVVPGLRSSRIHILDTRPDPRSPRVVRTIEAaELATKAGYSRPHTVHCGPHG-LYLSALGGAN 262 Frankia sp...
WP_012403483       81 lCPnaPHPHT---ERRYLVVPGLRSSRIHILDTKPDKRKPQIARVLEPaEVAEKAGYTRPHTVHCGPQG-IYVVSLANAQ 156 Paraburkho...
Q01W20             81 lCPysPHPHM---ERRYLVVPGLRSSRIHILDTKPDPKNPKLVKVIEPeTVMNRTGYSRPHTVHCGPEG-IYMNALGSPN 156 Candidatus...
XP_021131062       82 -CY--GDASK---RRNRLILPSLISSRIYVVDVGTDPKAPRIHKVVEPvELFWKGNVANPHTSHCLGNGDILISCLGDPS 155 mallard
CAF90090           79 -CF--GDASK---KRNRLILPSLISSRIYVVDVETDPRAPRIHKMVEPvDLFWKCGLANPHTTHCLGNGQIMISCLGDPA 152 spotted gr...
Q9VFZ4            162 G-YAKGDFILFDSD-FNCIGTWTKGDKKALCGYDFWYQPYFDVMVSSEWGAPNKWRRGWKNVDLEDMsQYGCRLNFYKWS 239 fruit fly
Q8ZUL2            158 GrEGPGGIFLLDHDtFEPIGRWEVYRGPQYFAYDFWWNLPSGVMITSEWTVPRCFEEGFSLECLKEG-AYGNKLHVWDLA 236 Pyrobaculu...
WP_012020924      161 G-EGPGGILLLDHFtFEPLGKWEINRGDQYFAYDFWWNLPNEVMVTSEWAVPNTIEDGLRLEHLEKG--YGNRIHFWDLR 237 Metallosph...
Q4JBV8            164 G-EEPGGILMLDHYsFEPLGKWEIYREDQKLSYDFWWNLPNEIMVTSEWATPTTIENGLNPEHLKEK--YGNRIHFWDLR 240 Sulfolobus...
Q1AZ66            157 G-DGPGGVFVMDHEsFDPLGRWEVERGPQQLAYDFWWHLGYDTMVTSEWGTPNMIEGGLDPQILLNK-GYGRRLHIWDLR 234 Rubrobacte...
jgi:Franean1_5378 263 GsDGPGGVALLDHDtFNVVGPWERDRGPQYLAYDVWWHLAQGVAVTSEWGTPSMIEDGVNAELLLGR-EYGHALHFWDLD 341 Frankia sp...
WP_012403483      157 G-EAPGGIFLMDHEtFDIRGQWEIDRGPQELSYDGWWHLGYDTVVTSEWGLPATFENGLVPEVLLGG-QYGHRLHFWDMN 234 Paraburkho...
Q01W20            157 G-EGPGGVFVLDGEtFDVRGRWELDRGPQYLAYDFAWHLGHDSMITSEWGTPNMFEEGLNAELLVGG-KYGHQIHVWDLQ 234 Candidatus...
XP_021131062      156 G-NGKGGFLLLDGEtFEVKGNWEKGEKXPPFGYDFWYQPRHNVLMSTEWGAPKVLANGFNPADVEKG-HYGRHINVWDWN 233 mallard
CAF90090          153 G-NGKGGFVLLDGQtFQVVGNWEHPGEAAPFGYDFWYQPRHNVMISTEWGAPKALAHGFDPADVAAG-HYGRCLHVWDWS 230 spotted gr...
Q9VFZ4            240 TQTLYQTIDLgSDGITPLEIRFLHNPKKAEGFVGCA-----LNAKVFHFKKKSD----SDeFEAKKVIDIPGKLVDtgSG 310 fruit fly
Q8ZUL2            237 KRRHLYAIDLgQEHRMVLEVRPLHDPTKLMGFVNVVlntkdLSSSIWLWFY-ED----GK-WQAERVIDIEAQPFE--GP 308 Pyrobaculu...
WP_012020924      238 RRKRVSSITLgEENRMALELRPLHDPTKLMGFINMVvslkdLSSSIWLWYF-ED----GK-WNAEKVIEIPAEPGE--G- 308 Metallosph...
Q4JBV8            241 KRKKISSITLgEENRMALELRPLHDPTKLMGFINLVvslkdLSSSIWLWFF-ED----GK-WQAQKVIDIPAEPAE--GN 312 Sulfolobus...
Q1AZ66            235 RRRHLQALDVgEEHQMVLELRPAHDPARTYGFVGVVvsledLSASVWLWHR-QN----GS-WGIRKVIEIPAEPAE--PD 306 Rubrobacte...
jgi:Franean1_5378 342 SGRHRQTVDLgDDNQMVLEVRPAHDPRASHGFAGVVtnvtdLSASVWLWYR-DG----DR-WAARKVITIPPEPAE--PA 413 Frankia sp...
WP_012403483      235 TRKHKQVVDFgAENQLVFELRPAHDPTKAYGFVNSVislkdLSASIWTWYR-DG----DQ-WAARKVIEIPAEPAD--AS 306 Paraburkho...
Q01W20            235 KRKHKQVLDLgAEQQLVFELRPARNPTKAYGFVGVVvslkdLSSSIWVWYQ-DGratdTA-WKIRKVIEIPAEPAN--PE 310 Candidatus...
XP_021131062      234 SHTYIQKIDLgKDS-IPLEIRFLHNPDAAEGFVGCA-----LNSTVHRFYKTEK----GN-WAAEKVIEVPSKKVQ--GW 300 mallard
CAF90090          231 THRKLQTIDLgEDGGIPLEVRFLHQPSAAQGYVGCA-----LSGSVFRFYRTAE----GD-WAAEPVITVPSKKVE--GW 298 spotted gr...
Q9VFZ4            311 VAEDM----------------------GGMISDIIISLDDRFLYVNCWRHGDVRQYDITDPENPKLTGQLFLGGAICSDl 368 fruit fly
Q8ZUL2            309 -LPPVlkdf---------------kmvPPLVTDIDISLDDRFLYVSLWGLGELRQYDITNPHQPRLAGRVKIGGLYHRE- 371 Pyrobaculu...
WP_012020924      309 -LPEIikqf---------------kvvPPLVTDIDLSLDDKFLYVSMWGIGEVRQYDVSDPFRPRLAGKVRLGGILHRA- 371 Metallosph...
Q4JBV8            313 -LPDIlkpf---------------kavPPLVTDIDLSLDDKFLYVSLWGTGELRQYDVSNPFKPVLTGKVKLGGILYRA- 375 Sulfolobus...
Q1AZ66            307 QLPPLlkdf---------------gavPPLVTDINLSLDDRFLYVSCWGTGELRQYDVSDPFNPRHTGSVRLGGIVRKA- 370 Rubrobacte...
jgi:Franean1_5378 414 DLPPVirpf---------------gavPALVTDIDLSVDDRWLYVSCWGTGELKQFDVRNPFSPREVGSVRLGGIVRRT- 477 Frankia sp...
WP_012403483      307 LLPPMlkgf---------------gavPPLVTDIALSLDDRFLYVSCWGTGDLRQYDVSDPMKPELTGTVRIGGIAARA- 370 Paraburkho...
Q01W20            311 LLPPMlkgf---------------gavPPFVTDINLSLDDKYLYVSCWGSGEFRQYDVSDPFHPKLNSKVQMGGIARRA- 374 Candidatus...
XP_021131062      301 LLPDM----------------------PGLITDVLISLDDRFLYFSNWLHGDIRQYDISNTRKPKLVGQVFLGGSIIKGg 358 mallard
CAF90090          299 ILPEMpgesvtrlspvchpsvsspvvlPGLITDILISLDDRFLYFSNWLHGDVRQYDITDRTKPRLVGQVFLGGSIVSDg 378 spotted gr...
Q9VFZ4            369 pnvivkedkelkerpPARYVKGRRLEGGPQMLQLSLDGKRLYVSSSLYSPWDKQFYPKMVSQGGHIVLIDVDTVNGGISL 448 fruit fly
Q8ZUL2            372 ---------------PHPSGA--EATGAPQMISVSRDGRRVYITNSLYSSWNNQFYP-GL--RGWMAKVNVNPE-GGLEL 430 Pyrobaculu...
WP_012020924      372 ---------------DHPSGF--RLTGGPQMLEVSRDGRRIYVTNSLYSTWDNQFYPEGL--KGWMVKINSSQD-GGLEV 431 Metallosph...
Q4JBV8            376 ---------------DHPSGN--KLTGAPQMVEISRDGRRIYVTNSLYSSWDNQFYPEGV--KGWLVKLNANPE-GGLDI 435 Sulfolobus...
Q1AZ66            371 ---------------AHPASG--PLNGGPQMVEVSRDGRRVYFSNSLYASWDEQFYPVGI--RGWIAKAEADPG-GGLSL 430 Rubrobacte...
jgi:Franean1_5378 478 ---------------PHPAAPDEPLAGGPQMVEISRDGRRVYLTNSLYAAWDDQFYPDGV--GAWMARLDADADAGGVSP 540 Frankia sp...
WP_012403483      371 ---------------THPAAGERPLNGGPQMVEVSRDGSRVYFTNSLYGAIDDQFYTEGL--DGWMVSLDAGKN-GGLAV 432 Paraburkho...
Q01W20            375 ---------------AHPSNPGTPLNGGPQMVELSRDGRRVYVTNSLYNAVDDQIYPDGI--KGWMMKMDVDSNTGAMRV 437 Candidatus...
XP_021131062      359 pvtvved-kelqcqpEPFVIKGKRVQGGPQMIQLSLDGKRLYVTSSLYSGWDKQFYPDLVKEGSVMLQVDVDTERGGLKV 437 mallard
CAF90090          379 pvkvle---qpekqpRPRFIQGRRVPGGPQMLQLSLDGLRLYVTTSLYSGWDQQFYPDMIKEGSVMMQIDVDPA-GGLSV 454 spotted gr...
Q9VFZ4            449 NEDFLV---DFANEPYGPSLPHEMRYPGGDCTSDIWL 482 fruit fly
Q8ZUL2            431 EKEFFV---DFGR-----ARAHQVRLWGGDASTDSFC 459 Pyrobaculum aerophilum
WP_012020924      432 DKEFLV---DFGE-----ARAHQVRLKGGDASSDSYC 460 Metallosphaera sedula
Q4JBV8            436 DKEFFV---DFGE-----ARAHQTRLRGGDASSDSYC 464 Sulfolobus acidocaldarius
Q1AZ66            431 DPGFFT---EVGDG----LRPHQIRLEGGDSSSDSYC 460 Rubrobacter xylanophilus DSM 9941
jgi:Franean1_5378 541 DVRFFPrgaDFRG-----LRVHQIRLEGGDASSDSYC 572 Frankia sp. EAN1pec
WP_012403483      433 AKNFFV---DWPKS----HRPHQIRLEGGDASSDSYC 462 Paraburkholderia phymatum
Q01W20            438 DPRFFP---QFDG-----MRPHQTRLEGGDASSDSYC 466 Candidatus Solibacter usitatus Ellin6076
XP_021131062      438 NKNFLV---DFGKEPDGPVLAHEIRYPGGDNTSDIWI 471 mallard
CAF90090          455 NENFLV---DFGQEPDGPVLAHEVRYPGGDCTSDIWL 488 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap