Conserved Protein Domain Family
BES1_N

?
pfam05687: BES1_N 
BES1/BZR1 plant transcription factor, N-terminal
This family consists of the N terminal regions of several plant transcription factors. It is classified as BES1/BZR1, a plant-specific transcription factor that cooperates with transcription factors such as BIM1 to regulate brassinosteroid-induced genes.
Statistics
?
PSSM-Id: 399005
Aligned: 23 rows
Threshold Bit Score: 133.715
Threshold Setting Gi: 1229748543
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O80831        66 GSRRSRPLEEKERTKLRERHRRAITARILGGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsksQGTKPTGg 145 thale cress
Q7XI96         7 AAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYR---KGCKPPP- 82  Japanese rice
XP_009411027   4 GGGRQPTWKERENNKRRERRRRAIAAKIFTGLRAMGNYKLPKHCDNNEVLKALCREAGWIVEEDGTTYR---KGCKPPPp 80  wild Malaysian ...
EEF52534      15 AARRKPSWRERENNRRRERRRRAIAAKIFSGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEDDGTTYR---KGCRPPP- 90  castor bean
XP_002890330  18 ATRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYR---KGHKPLP- 93  Arabidopsis lyr...
AST35781      11 TSRRKPSWRERENNRRRERRRRAIAAKIYSGLRAQGNFNLPKHCDNNEVLKALCAEAGWCVEEDGTTYR---KGCKPPL- 86  soybean
Q0E497        58 GGGEREREREKERTKLRERHRRAITSRMLSGLRQHGNFPLPARADMNDVLAALARAAGWTVHPDGTTFR---ASSQPLHp 134 Japanese rice
XP_014755446  48 rrGEREREREKERTKLRERHRRSITSHMLAGLRQHGNFPLPARADMNDVLAALARAAGWTVQPDGTTFR---SSPQPLLp 124 stiff brome
EEF42523      70 GRGKREREKEKERTKLRERHRRAITSRMLAGLRQYGNFPLPARADMNDVLAALAREAGWTVESDGTTYR---QSPAP--- 143 castor bean
KRH76424      54 GKGKKEREKEKERTKLRERHRRAITSRMLAGLRQYGNFPLPARADMNDVLAALAREAGWVVDADGTTYR---QCPPP--- 127 soybean
O80831       146 ssaVAAGSSASHiASQQTSPPAlRVVSSGLRSPVEL-------SSCRmkgvfTPAPSPYdmlpiqspelVGSvnkAE 215 thale cress
Q7XI96        83 ---SSAGGASVG-MSPCSSTQLlSAPSSSFPSPVPSyhaspasSSFP-----SPSRID-----------NPSa--SC 137 Japanese rice
XP_009411027  81 ppeSAMGGPSAG-ISPCPSSHQlSPLSSAFTSPVPSyhaspssSSFP-----SPSRLDNa--------nNPSmnpSC 143 wild Malaysian banana
EEF52534      91 ---IDIVGTSAR-ITPYSSQNP-SPLSSAFPSPIPSyqvspssSSFP-----SPTRGDN----------NHNnaaSS 147 castor bean
XP_002890330  94 ---GDMAGSSSR-ATPYSSHNQ-SPLSSTFDSPILSyqvspssSSFP-----SPSRV------------GDPhniST 148 Arabidopsis lyrata...
AST35781      87 ---ANGAGSSMRnITFSSSQNP-SPLSSSFPSPIPSyqvspssSSFP-----SPFRLD-----------VDKdnvSH 143 soybean
Q0E497       135 ptpQSPGIFHVN--SVETPSFTsVLNSYAIGTPLDSq-----aSMLQtddslSPSSLDSvvvad-qsikNEKygnSD 203 Japanese rice
XP_014755446 125 ppaQFQGAFQVT--SVETPALAnALNSYAVGTPLDSq-----tSALQtddslSPSSLDSvvvae-qsikNENygnSC 193 stiff brome
EEF42523     144 ---SQLGSFGVR--SVESPVSTaKA-----AAALEChnh-hqqSVLRideslSPPSLDSvvmte-gdtrTDKfapLT 208 castor bean
KRH76424     128 ---SNVGSFAAR--SVESQLSGgSLRNCSVKETIENq-----tAVLRideclSPASIDSvviae-rdskNEKytnAR 193 soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap