Conserved Protein Domain Family
DUF819

?
pfam05684: DUF819 
Protein of unknown function (DUF819)
This family contains proteins of unknown function from archaeal, bacterial and plant species.
Statistics
?
PSSM-Id: 114410
View PSSM: pfam05684
Aligned: 6 rows
Threshold Bit Score: 347.07
Threshold Setting Gi: 75180453
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8P790  17 GLIAATLGAVFWTsarERGPWQRFYAVVPALLLCYLLPGIYNTVGLI-DGANTWLYNPIARDVLLPAALILLTLSIDLRA 95  Xanthomonas campestri...
Q9K8K1  10 SILIGMTALIVWA---EYKIGGKFFKYVPAIVLIYLGAAFMNTFGLFgDSESLSNTSYGVRNALLPAMILLMLLQCDLRK 86  Bacillus halodurans
Q8RIK4  11 AFLMCLAGCLLLL---EKYSKWKIFNVVPALVFIYILNMFFCTMGLF-DSEACSKAYSVLKNNLLYAMIFVMLLRCDFRK 86  Fusobacterium nucleat...
O31634  15 GFIAVWAAVSIGL---EQRFKWA--SAVSGAIIALAGAMVFTNVGVL---PVESPVYDTVWSYVVPLAIPLLLFQINVRQ 86  Bacillus subtilis sub...
Q9FLW1  79 AALFAAGAFGVWS----EKTKIG--SMVSGALTSTLLGLAASNLRLI---PFETPSYGFFMEFLLPHTIPLLLFRADLRR 149 thale cress
Q9LTG3  95 TALFATGALGLWS----EKTKVG--AAMSGALVSTLVGLAASNLGII---SSQAPAFAVVLNFLLPLAVPLLLFRADLRR 165 thale cress
Q8P790  96 ILRLGPKLVAMYLGASLSIMLGAVVAFWVMRWLhpatVAGDTWAGMAALAGSWIGGGANMLAMREVFAVNASTFGQFAVV 175 Xanthomonas campestri...
Q9K8K1  87 IIKLGPKLLITYFVAAFSIVLGFTLTYLVMQSF----FLDDTWRAFSALAGSWTGGSANMVALQDILAVPETIFGYALIM 162 Bacillus halodurans
Q8RIK4  87 LAKLGGRMVAIFLACSFTLFIGFIVGYPIFKSF----LGTDVWGAVAALYASWVGGSANMAAMQAALPVDAGAYSCALAL 162 Fusobacterium nucleat...
O31634  87 IFKESRRLLFIFLISSVGTVLGSILAFFLLKQH-----IPYLDKIGGMISASYIGGGVNFAAMAAKFETPGEYVSATVVA 161 Bacillus subtilis sub...
Q9FLW1 150 IIRSTGSLLLAFLIGSVATIVGTVVAFMLVPMRs---LGPDNWKIAAALMGSYIGGSLNFVAISEALQISPSVIAAGVAV 226 thale cress
Q9LTG3 166 VVQSTGKLLLAFLIGSVATTVGTALAYYLVPMKs---LGPDSWKIAAALMGRHIGGAVNYVAISNALGVTPSVLAAGLAA 242 thale cress
Q8P790 176 DVGVGYVWMAVLIFLAGRARSIDARSGADTRALDALQERMARFQAEHARIPSL-SDLMVIVAVAFGGVGLAHALANPLAg 254 Xanthomonas campestri...
Q9K8K1 163 DTINYSFWVMVMFWLVPFERMFNRWTKADTSKLESMSQEIAATVTDEKREPTTfVHMIGLLGFSLFIAALATVIGENLP- 241 Bacillus halodurans
Q8RIK4 163 DTVCYSVWIALLLLMVRYSSKWDNATKADTSKLQAVADAAAKEVEKEKKTASA-ADWIFLIGISLMVSAVSQMVGAHLQ- 240 Fusobacterium nucleat...
O31634 162 DNFMMALLFFILISIPALKWFQRHYAMPFEEKVKADGNSGNSAESYWKRKDISlKDIAFNAGAAFALVAVSMKVSGYFKs 241 Bacillus subtilis sub...
Q9FLW1 227 DNVICALHFMVLFALAS-------KIPPETASASSPDADMTKDDKLEDKNRV--VSTSIALSVSFLICKAAITLTTLF-- 295 thale cress
Q9LTG3 243 DNVICAVYFTTLFALGS-------KIPAEAVPPPTTIVDAETNEASETKNKIPvLLIATGIAVSLAICKAGALLTKYF-- 313 thale cress
Q8P790 255 wckvNLSWARqfsldTPFVWVVVLATSLGLLLSFTRARTLegAGASKIGTLLLYFLIACIGMQMDLLALLD-RPWLFLLG 333 Xanthomonas campestri...
Q9K8K1 242 ----QIGTGI-----NAMTWTILIVSIVGLLLALTPFASI--PGSMDIGRVMLYTIVAIIASGADFSSIGE-IPVYIIAG 309 Bacillus halodurans
Q8RIK4 241 ----NAFASVglevfDKGTMTTVFVTILGLVCALTPLGKL--PAVEELSTVYLYAVVSLLASTASVVDLLT-APMWIVYG 313 Fusobacterium nucleat...
O31634 242 ifshPLLTGT-----LGDQYLVLTSLTVLIIFLFPRFFERl-NGSQELGTFLIYLFFVVIGIPADLRLIVTnAPLILLFV 315 Bacillus subtilis sub...
Q9FLW1 296 --------KI-----QGVMLPAVTAITIVLATSFPDFFNSlaPSAETISLILMQVFFTILGATGSVWNVINtAPSIFLFA 362 thale cress
Q9LTG3 314 --------GI-----SGGSLPAITAVVVILATVFPSQFGRlaPSGEAMALILMQVFFTVVGASGNIWSVINtAPSIFLFA 380 thale cress
Q8P790 334 LSWIAVHIVLLLGLGRLLRVPFFYFAIGSQSNIGGPASAPVVAAAFH-PALAPVGVLLGTMGYATGTYLAYLVGITLRAM 412 Xanthomonas campestri...
Q9K8K1 310 FMVLLFHGLILFGFAKLFKLDLFTLGVASLANIGGMVSAPVLAGAFN-RALIPVGVIMALIGGFMGTWFGVLTAEILSRL 388 Bacillus halodurans
Q8RIK4 314 LFILAIHVVLMFVLSKMFHWDLCMVSTASLANIGGSASAPIVASAYN-PSYAGIGVLMGVLGAAVGNFFGIGIGQILKML 392 Fusobacterium nucleat...
O31634 316 FIIAISNLAVSLAAGKLFRVRLEEILLAVNATVGGPTTAAAMAIAKGwRELVAPIMLVGTLGYLIGNYVGTFMGNWFSSF 395 Bacillus subtilis sub...
Q9FLW1 363 AIQVMVHLAVTLVLGKLFCIDMKLLLLASNANIGGPTTACAMATAKGwTSLVVPGILSGVFGVSIATFLGIGCGVFVLKR 442 thale cress
Q9LTG3 381 LVQIGTHLAVILGIGKLLNIELRLLLLASNANVGGPTTAAGMATAKGwNSLIVPGILAGIFGIAIATFIGIAFGVKVLKF 460 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap