Conserved Protein Domain Family
DUF817

?
pfam05675: DUF817 
Protein of unknown function (DUF817)
This family consists of several bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 398998
Aligned: 53 rows
Threshold Bit Score: 265.588
Threshold Setting Gi: 81392685
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6F9M2           9 LFVFKAASAALFGLLLLIAFAVTAP-MGSHEYygFFRYDYLLFYALLIQICLLCLKLETWAEARVIALFHIMAMGMEVFL 87  Acinetobacter...
WP_011693392    36 VFGLKQGWACIFGAALLAVLLAARLwYPDDAG--LARNDFLTLAAVVIQILMVATRLETVRELRVIVLFHIVGTVMELFK 113 Arthrobacter ...
EFP01138        40 VFLLKQAWACVFGALLLAVIVAARLwYPEDAV--LARNDALTIAAIVIQIGMLAFRLESGRELWVIVLFHITGTAMELFK 117 Caenorhabditi...
BAJ74912        49 VFVLKQAWACVFGAAFLAVVLAAKLwYPADAP--LARNDALTIAAILIQIVMVVGRLETLRELRVIVTFHIVGTVMELFK 126 Microbacteriu...
jgi:Celgi_1376  54 VFGLKQAWACLFGALMLAAILASRLwYPDDAP--LARNDALTLVAIAIQVLMLVTRLETVRELRVVLTFHVVGTVMELFK 131 Cellulomonas ...
Q1GSL5          36 VFGFKQGWACLFGGLMLALLLGTHFfWPDDAP--LHRYDAITIGAVLIQLAMLAFRLETPKEALVILIFHIVGTVMELFK 113 Sphingopyxis ...
jgi:Bresu_1615  38 MFGIKQAYACLFGGAMLGLILVTFLlWPDDAP--VSRYDFLVVGAVLIQAAMLGLKLESWAEARVILLFHIAGTIMELFK 115 Brevundimonas...
Q9AAY4          26 LFGLKQAWACLFGGLMLALLVGTKLfWPEAAP--IARYDFLVVAAIAIQASLLALKLERWDEALVIFMFHVVGTIMELFK 103 Caulobacter v...
Q0C2P1          14 SFGIKQAWACLFGGVMLALLLLTHFfYPEGAG--LSRYDFLVIAAIALQGLLLLSGLETWEEARVIFVFHVVGTVMELFK 91  Hyphomonas ne...
Q0ANW7          14 SFGIKQAWACLFGGLMLAMLVVTFLwYPGDAA--LSRYDAITIFAVAIQLTLILTRLETLEEAKVIAIFHVVGTVMEIFK 91  Maricaulis ma...
Q6F9M2          88 THpaIASWQYPQPAIFRLWTVPLFAGFMYSAVGSFFARSLRLYQVSFIALPRFGNMLILALCSYINFMSKFFIPDIRGVL 167 Acinetobacter...
WP_011693392   114 TD--VGSWSYEAEGFLRIGAVPLFSGFMYAAVGSYMVRVYRLFDLRFARYPRRWITAVIAAAVYVNFFTHHYTWDARWVL 191 Arthrobacter ...
EFP01138       118 TD--VGSWSYDGEGVLRIGAVPLFSGFMYAAVGSYMVRVYRLHDLRFARYPKVWLTAIVAALIYLNFFGHHFVFDFRWIL 195 Caenorhabditi...
BAJ74912       127 TD--VGSWMYAADGVLRLGGVPLYSGFMYAAVGSYMVRVYRLFDLRFTRYPRQWLTAVVAVLIYANFFTHHWIIDLRWVL 204 Microbacteriu...
jgi:Celgi_1376 132 TD--VGSWAYAADGVLRIGAVPLFSGFMYAAVGSYLVRVMRIFDLRFDRYPRRWVTAVLAAAIYANFFTHHWVADARWVL 209 Cellulomonas ...
Q1GSL5         114 TA--AGSWQYPEASLLHIGAVPLFSGFMYAAVGSYIARVWRIFDFRYTGYPPAWTSYVLAAAIYINFFAHHWTYDIRWFL 191 Sphingopyxis ...
jgi:Bresu_1615 116 TA--HGSWVYPEDSVLRIGAVPLFSGFMYAAVGSYIARVQRIFHIRVRGYPPVWTTWVLAAAIYVNFFAHHWLPDIRTGL 193 Brevundimonas...
Q9AAY4         104 TA--HGSWIYPEDSVLRIGGVPLFTGFMYACVGSYIARIWRLFDITFIRYPPFWTTHILAVLIYANFFTHHYMIDIRVGL 181 Caulobacter v...
Q0C2P1          92 TS--AGSWIYPEESFLRIGAVPLFSGFMYAAVGSYLARVWRIFEFRFTRFPPLWLQGLLAAAIYVNFFAHHWTVDIRFGL 169 Hyphomonas ne...
Q0ANW7          92 TQ--AGSWVYPEDSLLRIAGVPLFSGFMYAAVGSYIARVWRIFDFRFDRFPNLWLQFALAAAVYINFFTHHYGPDIRVFL 169 Maricaulis ma...
Q6F9M2         168 FVWSVVIFWKTRLHFKLDGRELHLPMLPVLMVLAFLIWIAENISTFYKIWLYPSQvDAWHMVGWTKLGSWYLLLLLSL 245 Acinetobacter b...
WP_011693392   192 LAAVVIVFGRCVMHFRVFRRTFRMPLVLAFLLVALFIWIAENIATWSGAWLYPNQvDGWHMVSPDKLVSWFLLMIISV 269 Arthrobacter sp...
EFP01138       196 LAAVVVLWLPTVMHFRVWRTTLRVPILPVFVGVALFIWFAENIGTWAGAWFYPNQtDGWHLVSPQKIVAWFLLMIISI 273 Caenorhabditis ...
BAJ74912       205 IAAVVVLWGRTMMHFRFFRGRFRMPILLAFAGVAVFIWLAENIATYAGAWLYPSQvGAWHPVDVSKLSSWFLLMIVSV 282 Microbacterium ...
jgi:Celgi_1376 210 VAAVLVVFGRSVMHFRVLHRVRRMPVVVAFVLVATFIWLAENLATRAGAWLYPAQaDGWHPVSVQKLAAWFLLMIISV 287 Cellulomonas gi...
Q1GSL5         192 FAATGLLFWRCQVWFRPLHVHRRMPLLVGWGLVALFIWFAENIGTFARAWTYPSQnDGWHMVGLEKLGSWYLLMIISF 269 Sphingopyxis al...
jgi:Bresu_1615 194 FVATALLFGRGWFWFTANRTRLKMPLLLGYLLVALFIWFAENLGTLGRAWAYPGQqAGWEMVSVSKLGSWFLLMIISV 271 Brevundimonas s...
Q9AAY4         182 FALSVLLFGRTWFVFTPDQTARRMPMLMGAVLVSLFIWFAENLGTFAGAWIYPNQaDGWQMVPFEKMGAWYLLMLISF 259 Caulobacter vib...
Q0C2P1         170 FAATALIYLRTTVWFRPDEAHRPMPLLIGFLLVAIFIWFAENLGTFARAWAYPGQeNGWEMVSLSKLGSWYLLMIISF 247 Hyphomonas nept...
Q0ANW7         170 FLATMLIYGRCVVWFRPDEAHRPMPLVIGFLLVALFIWFAENLGTFARAWSYPGQeVSWHMVSLAKLGSWYLLMIISF 247 Maricaulis mari...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap