Conserved Protein Domain Family
DUF815

?
pfam05673: DUF815 
Protein of unknown function (DUF815)
This family consists of several bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 398997
Aligned: 58 rows
Threshold Bit Score: 289.038
Threshold Setting Gi: 123491135
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4FRH0            37 PAQLAYRWVG-GQTGHLEPLAVNLFLNLDDLHGIDTQKSKLVQNTCQFLKGYPANHVLMTGTRGAGKSSLIRALLQAYHN 115 Psychrobact...
Q0VT20            11 RHTPAAIWR--GRSQTLRPVPHPDPVRLDDLLGIAPQKAKLVQNTERFLAGQPCNHVLLWGSRGTGKSSIVKALLNEYSP 88  Alcanivorax...
Q7MAC3             4 EEIYAAIYR--PMGRYLHAVREIDEVRLENLGGIERQKRLLVKNTKRFLRGEPAVNALLWGARGTGKSSLIKALLWEYAK 81  Wolinella s...
Q1QTK2            30 SRDVAALWQRnALGGQLMPVAARDGVTMDDLVGVERQKAALLANTRAFLHGRPANHALLWGARGSGKSSLVRALLNTLAP 109 Chromohalob...
Q39SI4            33 STCYAANWRRhSFSGFLQAVRVTDTTSLHELLGVEKQKEIMISNTRQFLKGLPANNALLWGSRGTGKSSLVKALLNEYAC 112 Geobacter m...
jgi:Ppro_0751     32 SKSHAANWRRhSFSGYLEPVKFTDTTTLDELLGVEEQKTIMINNTRQFLAGLPANNALLWGSRGSGKSSLCKALLNEFAH 111 Pelobacter ...
jgi:Anae109_3364  32 RRCHAANWRRhSFAGYLEPVASVEGIQLSDLLGIEEQKRVVESNTRQFLAGYPANNVLLWGTRGTGKSSLVRALLRAYAA 111 Anaeromyxob...
Q2IDP3            32 ATCHAANWHRsTFAGTMEPVPGVEGIHLEDLLGIEPQKKALEDNTRQFLAGLPANNALLWGVRGTGKSSLVRALLHAYAD 111 Anaeromyxob...
WP_012470979      35 TETHAANWRRrGNGGYLDPVPEIEAFHLDDLLGIDEQKRTVEENTRQFLAGLPANNTLLWGTRGTGKSSLVRALLHSYAP 114 Geobacter l...
jgi:Gura_1583     32 AVCHAANWRRhSFSGYLESIPSIEGICLDDLLGIDKQKWDVEENTRQFLAGLPANNILLWGTRGTGKSSLVRAMLHSYAP 111 Geobacter u...
Q4FRH0           116 EGLRIIEIARDDLKMLDKIRAAIKalpaDCKCRYVVYCDDLAFNGQDESYRTLKSVLDGALDSEQDKLLVYATSNRRHLL 195 Psychrobact...
Q0VT20            89 RGLRVIEVDKDDLHDLPDIVDDIR----DRSQRFIIYCDDLSFEDGENQYKHLKSVLEGSLELPPENVRIYATSNRRHLL 164 Alcanivorax...
Q7MAC3            82 EGLRVVEVEKESLGIIPELTDRLR----ELPYHFILFCDDLSFERGDSSYKPLKSLLEGSIERLPQNIIVYATSNRRHLL 157 Wolinella s...
Q1QTK2           110 EGLRLIQVDRHDLVGLPGLVQRLR----DAPQRFIVYCDDLSFEGHDDAYKALKSVLDGTLTGPPENVLLYATSNRRHLL 185 Chromohalob...
Q39SI4           113 EGLRVIQVEKEDLIYLSDIFSAVE----GEPYRFILLCDDLTFEPGELTYKILKSALDGSVYSPPENVLIYVTSNRRHLL 188 Geobacter m...
jgi:Ppro_0751    112 QGLRFIQVEKEDLIYLSEIFNAVE----HEPYRFILLCDDLTFEVGELSYKMLKSALDGSVYSAPENVLIYVTSNRRHLL 187 Pelobacter ...
jgi:Anae109_3364 112 DGLRIIQVDKDDLVSLPAIVDQVS----GQPYRFILFSDDVSFEVGESSYKMLKSALDGSVYAPPENVLIYVTSNRRHLV 187 Anaeromyxob...
Q2IDP3           112 RGLRIIQVDKDDLVSLPGIVDAVK----GEPYRFVLFSDDLSFEPGDASYKVLKSALDGSVYALPENVLIYVTSNRRHLV 187 Anaeromyxob...
WP_012470979     115 QGLRVIQVDKDDLIHLPAIVDEIK----RQPYRFILFSDDVSFETGESSYKMLKSALDGSVYAPPENVLIYVTSNRRHLL 190 Geobacter l...
jgi:Gura_1583    112 EGLRVIQVDKDDLVHLPDIVDEVK----DQPYKYIIFSDDVSFEVGESSYKMLKSALDGSVYAPPDNVIIYVTSNRRHLI 187 Geobacter u...
Q4FRH0           196 PQLMKDNVNiyngqTDEVNPYETIDETVSLSDRFGLWLSFHPMDQNTYLHIVHHYLsiqqkidartlhdDMH----GDAA 271 Psychrobact...
Q0VT20           165 PEYMKDNEQtq-vvNRELHHGDVVEEKISLSDRFGLGLSFYPINETQYFDIVDHLF--------------------GTVQ 223 Alcanivorax...
Q7MAC3           158 PEYKSDNEGaw-vgEGEIHLGDAVEEKVSLSDRFALSLGFYQGTLKGYWELVQGYL--------------------GGES 216 Wolinella s...
Q1QTK2           186 PESLADNQDtr-lvDGELHHGDAVEERISLSDRFGLWLAFHPFNQDTYLDACRHWV-------------HHL----GSEA 247 Chromohalob...
Q39SI4           189 PEYESDNIGwk-lvNGELQESEATEEKIALSDRFGLWVPFHVFTQDRYLEAVRLCV-------------EREartrEVDI 254 Geobacter m...
jgi:Ppro_0751    188 PEYETDHLGgk-fvRGELQQSEAMEEKVSLSDRFGIWVAFYAFSQERYIDAVRLCI-------------AREarqnKIEI 253 Pelobacter ...
jgi:Anae109_3364 188 PEFETDNLGav-lvKNELHHGEAVEEKISLSGRFGIWVGFHAFSQDEYVAVARQWV-------------AKLcekmGAEL 253 Anaeromyxob...
Q2IDP3           188 PEYESDNRGam-mvEGEIHYGEAVEEKISLSGRFGLWVGFHTFSQDLYVDVARRWV-------------GKLcertGVKV 253 Anaeromyxob...
WP_012470979     191 PEYESDNRGam-lvNNEIHHGETVEEKISLSGRFGLWIGFHPFSQDQFLEVARQWV-------------ERLcqrnGSTL 256 Geobacter l...
jgi:Gura_1583    188 PEYESDNRGam-mvEGEIHHGESVEEKISLSGRFGIWVAFHPFSQDQYLEVVKQWV-------------GKLcqkkGAEL 253 Geobacter u...
Q4FRH0           272 NKgaesidelpTHIRAAALRWASERGGRSGRVAYQFSRYWIGQT 315 Psychrobacter arcticus
Q0VT20           224 DR---------EQLHVRARRFSMEKGVRSGRTARQFYNQFVGEF 258 Alcanivorax borkumensis SK2
Q7MAC3           217 YP---------VELEQKAINFATQKGSRSGRTAKQFYDLYRSGL 251 Wolinella succinogenes
Q1QTK2           248 DWs--------EQARVEAVRFATLRGVRSGRAAWQFACQWVGAA 283 Chromohalobacter salexigens DSM 3043
Q39SI4           255 PWs--------EQLRLDAIQWSHDKKKRCGRTAYQFSKHWVGKY 290 Geobacter metallireducens GS-15
jgi:Ppro_0751    254 PWs--------SELEHEAIKWAQEKSKRCGRTAYQFSRNWVGHH 289 Pelobacter propionicus DSM 2379
jgi:Anae109_3364 254 AWd--------RKAVEAAVAWSHQKGDRSGRIAYQFASHWVGQS 289 Anaeromyxobacter sp. Fw109-5
Q2IDP3           254 PWt--------REAETAAVLWSQRKGDRSGRIAYQFACDWVGRS 289 Anaeromyxobacter dehalogenans 2CP-C
WP_012470979     257 RWn--------EEARQAAILWGRQKGDHSGRIALQFANQWVGST 292 Geobacter lovleyi
jgi:Gura_1583    254 EWt--------KEAQDEAILWSQKKGDRSGRIAYQFASSWVGRK 289 Geobacter uraniireducens Rf4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap