Conserved Protein Domain Family
DUF810

?
pfam05664: DUF810 (this model, PSSM-Id:398991 is obsolete)
Plant family of unknown function (DUF810)
This family is found in plant-symbionts and pathogens of the alpha-, beta- and gamma-Proteobacteria, but is not known in any other organism. It represents a candidate family for involvement in interactions with plants, or it may at least play a role in plant-associated lifestyles.
Statistics
?
PSSM-Id: 398991
Aligned: 44 rows
Threshold Bit Score: 729.813
Threshold Setting Gi: 300171410
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEF33545           39 LDRDDIRETAYEVFFTACRSSPGFgggrnNITFYSNHHHhhhggggdanngggggpmspsgsssggrvgagggggagggg 118  castor bean
EFJ38010          119 LSDDDIRETAYEVLLASVGAAGGL----------MKKEE----------------------------------------- 147  Selaginel...
XP_006594370      193 ISDDDLRETAYEILLACAGATGGL-----IVPSKEKKKD----------------------------------------- 226  soybean
EEF49527          621 ITDDDLRETAYEVLLVCAGAAGGL-----IVPSKEKKKD----------------------------------------- 654  castor bean
Q8RX56            195 ITDDDLRETAFEILLACAGASGGL-----IVPSKEKKKE----------------------------------------- 228  thale cress
ERN19317          163 LSDDDLRDASYEVLVACTDVSRDM-----ILSSEGKKKD----------------------------------------- 196  Amborella...
XP_006652654      164 LSDDDIRETAYEVLLASLFFSG-------KIPFSEEKKE----------------------------------------- 195  malo sina
CBI34727          163 LSDDDLRESAYEIMLASIVFSGVQ-----VYTVQDRKKE----------------------------------------- 196  wine grape
EEF51128          169 LSDDDLRESAYELLLASIFL-PGY-------------------------------------------------------- 191  castor bean
JCVI:AT4G11670.1  166 LSDDDLREAAYELMIASMLLSSFL-----TNSVEAYPTH----------------------------------------- 199  thale cress
EEF33545          119 gAVVVLTPTSRIKRALGLKMIRRSPSRrmssgggggagsgpgspnapphnhngggyspgtgfntvpasRPRRPLTSA--E 196  castor bean
EFJ38010          148 ------S-----VSRSGKWKP-----------------------------------------------QSKASGLAClmS 169  Selaginel...
XP_006594370      227 ------K-KSSLIRKLGRSKSGSVVSQ-----------------------------------------SQNAPGLVGllE 258  soybean
EEF49527          655 ------K-RSKLMRKLGRSKSENV-VQ-----------------------------------------SDRAPGLNGllE 685  castor bean
Q8RX56            229 ------KSRSRLIKKLGR-KSESV-SQ-----------------------------------------SQSSSGLVSllE 259  thale cress
ERN19317          197 ------R-RTKFLSKLRTKKEKLQPQ------------------------------------------NCFAGSDFEllD 227  Amborella...
XP_006652654      196 ------K-KSKFLKGLRSKTEGSSPS------------------------------------------PQPENYDAHllD 226  malo sina
CBI34727          197 ------K-SSKFLSGFKGKMDKAHLQ------------------------------------------SQSLGRHSEliD 227  wine grape
EEF51128          192 --------------------------------------------------------------------SLFASACMCmsL 203  castor bean
JCVI:AT4G11670.1  200 -RRKIEK-SSRLMLSLKRKDKPHLQP-----------------------------------------------------Q 224  thale cress
EEF33545          197 IMKLQMR----------------------VTEQSDNRLRKTLMRTLVGQMGRRAETIILPLELLRHLKPSEFNDMHEYHL 254  castor bean
EFJ38010          170 IMRKQLEitvc---------------mgqISEENDKRTTDALFHASSGRLGKRTDSLLVPLELLCNTKREIFPDGTTYLN 234  Selaginel...
XP_006594370      259 TMRVQME----------------------ISESMDIRTRQGLLNALVGKVGKRMDTLLIPLELLCCISRSEFSDKKAFIR 316  soybean
EEF49527          686 IMRAQME----------------------ISEAMDVRTRKGLLNALAGKVGKRMDTLLIPLELLCCISRTEFSDKKAYIR 743  castor bean
Q8RX56            260 MMRGQME----------------------ISEAMDIRTRQGLLNALAGKVGKRMDSLLVPLELLCCVSRTEFSDKKAYLR 317  thale cress
ERN19317          228 TIRMQLE----------------------ISEAMDRCIRQSLIHTSSA-SRGPISIAVISLELLSNISKSSFSNEKAYIN 284  Amborella...
XP_006652654      227 LIRVQME----------------------ISGSMDALTRRALRLISLKMLQGHLDVPCISLQLLSSVGKSDFATERLRVQ 284  malo sina
CBI34727          228 TIRV-----------------------------MDLCMRQKLMQFATRKLCDRIDIPQISLGLLNSIFKSDFVHEKSYMQ 278  wine grape
EEF51128          204 SMRSRVLlmyvsmpicirlvcgihvcmpvLAEAMDACIRRNLMQLAARRMYGQIDLTHISLGLLNGVFKSDFRNEKSYMQ 283  castor bean
JCVI:AT4G11670.1  225 ISNTHSE----------------------ISSKMDTCIRRNLVQLATLRTGEQIDLPQLALGLLVGIFKSDFPNEKLYMK 282  thale cress
EEF33545          255 WQRRQLKILETGLLLHPAVPLEKSNSFA------MRLREIIRASDT--KSIDTSKNSDTMRTLCNSVVSLSWR-SPNGAP 325  castor bean
EFJ38010          235 WQKRLLNIVREGVLNNYHWNLDRSDHLA------MELMASIANVET----SAFKDRTDALKRVKDVYLAISGRnGKSE-- 302  Selaginel...
XP_006594370      317 WQKRQLKVLEEGLVNHPAVGFGESGRKTne---lRILLAKIEEAEFlpSSTGELQRTECLRSLREIAIPLAERpARGDLT 393  soybean
EEF49527          744 WQKRQLFILEEGLINHPVVGFGESGRKAsd---lRILLAKIEESEFrpSSEGEVLRTECLRSLREVAVPLAERpARGDLT 820  castor bean
Q8RX56            318 WQKRQLNMLAEGLINNPVVGFGESGRKAtd---lKSLLLRIEESESlpSSAGEVQRAECLKSLREVAISLAERpARGDLT 394  thale cress
ERN19317          285 WLKRQANILEELLAPPTNRNLETDLTML------KNLLSKIKHTTDw-ALMTPSKQGEVLTSIRRFASELAQRpGKFRIP 357  Amborella...
XP_006652654      285 WQRRQANVLEELLLYPGSHEYGMSETL-------RIILSKIKDTEDw-VVSVPNGRVEVLTIIERYNTKLCEApKKFNLK 356  malo sina
CBI34727          279 WKYRQANILEEVLYFF-------VNLKTaerltiKSSLAKIRNTKEwdFIMPPSERAEVLLAMKEVASKLASVpGQFGIH 351  wine grape
EEF51128          284 WKNRQANILEEFLCFSAVGNSSKANVMTaehlsiRSHVAKIRDEKEwdTIMSPSERVAVLASIRQFAVNMSSLpGKFRIE 363  castor bean
JCVI:AT4G11670.1  283 WKTRQANLLEEVLCFSPSLEKNERATM-------RKCLATIRDSKEwdVVVSASLRIEVLSSIRQVASKLSSLpGRCGIE 355  thale cress
EEF33545          326 TDVCHWADGFPLNLHIYTCLLQAIFDFRDETLVLDEVDELVELIKKTWSTLGINRPIHNLCFTWVLFQQYVVTSqtEPDL 405  castor bean
EFJ38010          303 -EPCHWADGYYLNVRLYEKLLFGIFDPVNSSQFIEEAEELLELLKSTWRVLGLNQIVHDTCFTWVIFKQFVVTG--EFFL 379  Selaginel...
XP_006594370      394 GEICHWADGYHLNVRLYEKLLLSVFDMLDEGKLTEEVEEILELLKSTWRVLGITETIHQTCYAWVLFRQYVITR--EHGV 471  soybean
EEF49527          821 GEVCHWADGYHLNVKLYEKLLLSVFDILDEGKLTEEVEEILELLKSTWRVLGLTETIHYACYAWVLFRQYIITQ--EHSL 898  castor bean
Q8RX56            395 GEVCHWADGYHLNVRLYEKLLLCVFDILNDGKLTEEVEEILELLKSTWRVLGITETIHYTCYAWVLFRQYVITS--ERGL 472  thale cress
ERN19317          358 GETYFWTGAYHLNIRLYEKLLNSVFDILEEGKLLEEVDEILEFLRATWPTLGITPQIHDALYAWVLFQQFVLTG--ESML 435  Amborella...
XP_006652654      357 GETYHWIQSYHLNFRLYEKLLSIVFDVLEDGQLVEEADEILEAIKLTWPILGITQKLHDTFYAWVLFKKFAQTG--EIFL 434  malo sina
CBI34727          352 DETCYWTAGYHLNIRIYEKLLFGMFDVLDEGQLIEEADEILMLIKLTWSSLGINQRMHNVLYGWVLFQQFVGTD--EATL 429  wine grape
EEF51128          364 GETYYWTASYHLNIRLYEKLLFGVFDVLDEGQLVEEAGEVLSRIKSTWAALGITQKLHNALYGWVLFRQFVETD--GGQL 441  castor bean
JCVI:AT4G11670.1  356 EETYYWTAIYHLNIRLYEKLLFGVFDTLDEGQVIEDASSMLFHMKSIWSTLGITENLHSAIYGWVLFQQFVCTG--EPSL 433  thale cress
EEF33545          406 LYAAHAMLStEVAN-DAKKpDREATYVK----------------LLASMLASMQGWAERRLLHYHDYFQRGNVFLIENLL 468  castor bean
EFJ38010          380 LQHAQRQMK-LITFdRPRT-VAERAYLKttkhg------nldvsYVQAVLGSIKSWIDKQLNDYHLYFQH-DRTKMEAVL 450  Selaginel...
XP_006594370      472 LLHALEQLN-KIPLmEQRG-QQERLHLKslhskve---gerdmsFLQSFLTPIQRWTDKQLGDYHLHFNE-GSATMEKIV 545  soybean
EEF49527          899 LQHAIQQLK-KIPLkEQRG-PQERLHLKslcsrv----egedlsFLQSFLSPIQKWADKQLADYHKNFAE-ESATMEDVV 971  castor bean
Q8RX56            473 LRHAIQQLK-KIPLkEQRG-PQERLHLKtlkcrv----dneeisFLESFLSPIRSWADKQLGDYHLHFAE-GSLVMEDTV 545  thale cress
ERN19317          436 LEQATLQMH-KVPMdKDCA-AHEREYVDgltcaievshsrrnlsLIHAVLMSINLWCENRLTDYHLYFSE-DSSNFEVVV 512  Amborella...
XP_006652654      435 LRHTCLQTQ-KLRLnNDAKe--iELYTNsfvcsveacgrdmalsLVDSAILKINEWCHRQLENYHAYFNKVNNSIFEGVL 511  malo sina
CBI34727          430 LEYAILEVQ-QVLStEDID-GKEEQYMNslvcsrvfngkekklsLVEAIFFSMSIWCDSKLLDYHLHFSK-KLDNFKTVM 506  wine grape
EEF51128          442 LEDAVLELQ-KFVSaEEAD-GKEEQYMNslvcsrqcdqrevklnLAQSICLSISIWCDSTLQDYHLHFSQ-KPSCFRTLM 518  castor bean
JCVI:AT4G11670.1  434 LGSTIQELQ-KVTSaESGN-PKEDLYLShlvcsrqtigtdihlgLVKAILTSVSAWCDDKLQDYHLHFGK-KPRDFGMLV 510  thale cress
EEF33545          469 PL--------------ALSASKILGEDVTITEGAGKqptr-------------ivdSSGDRVDHYIRASIKNAFAKIIET 521  castor bean
EFJ38010          451 AI--------------VVTSARLLTEeetkap------------------gisntlVIAKLIEGYISSSIKEAYARV--- 495  Selaginel...
XP_006594370      546 AV--------------AMITRRLLLEepetst-------------------qslpiSDRDQIEIYISSSIKNAFSRTVQV 592  soybean
EEF49527          972 LV--------------AMVTRRLLLEesdq-----------------------gslTDRDQIESYISTSIKNAFTRILQA 1014 castor bean
Q8RX56            546 TV--------------AMITWRLLLEesdra--------------------mhsnsSDREQIESYVLSSIKNTFTRMSLA 591  thale cress
ERN19317          513 NS--------------AVVIKRLVSLecgenkvv--------------nqsvtereLVSEQIKNYITRSIQAAYLRVVNA 564  Amborella...
XP_006652654      512 NLvvisatgqtdddekAMLIGTPFda-----------------------------tPEFTLIHILVVRSIQAAYKNALIS 562  malo sina
CBI34727          507 TL--------------ALAVGFITSS-------EGGeikvkkfsylqltktngldeIAAKKLQTYIQKSIEAAYSRVAAT 565  wine grape
EEF51128          519 TL--------------FSAVGVLTVDdhgeiklt---------------klgasddYVSGKLKSYVNKSTEAVYGRAAKK 569  castor bean
JCVI:AT4G11670.1  511 RL--------------ASTVGLPPADCTRTELIKLDtl----------------sdDVSDKIQSYVQNSIKGACARAAHF 560  thale cress
EEF33545          522 GSYKStsvevKDEASEALLQLAKETEDLASRERESFSPILKKWQSIAASVAAVTLHHCYGAVFKQYLAGMST-LNYESVE 600  castor bean
EFJ38010          496 -----------------------HTKKLADYDITFFSPLLCRWGPLSVAVTASVLHAAYFKELKPCLERLSTsPDDEVTS 552  Selaginel...
XP_006594370      593 VDRV------DMSHEHPLALLAEELKKFLKKESASFLPILSQRHPQATVVSASLVHKLYGHRLKPFLDSAEH-LSEDVIS 665  soybean
EEF49527         1015 VERL------DTMHEHSLALLAEETKKLLRKESTIFTPILSRRHPQAIIFSASLLHRLYGMKLKPFLDGAEH-LTEDVVS 1087 castor bean
Q8RX56            592 IDRS------DRNNEHHLALLAEETKKLMKKDSTIFMPILSQRHPQAIAFSASLIHKLYGNKLKPFLDGAEH-LTEDAVS 664  thale cress
ERN19317          565 LDTKG-----AAEGKPPLALLADEIKFIVERERTVFTPVLCHWCPDARVSSILLLHRLYGQRLRPFLEGVSQ-LSKDARS 638  Amborella...
XP_006652654      563 SDCES-----KAEFKHPLIILANKLKLVAEKECNVFSPTLCKRYPEAGRVALVLLHLLYGQQLELFLERIDS--SENLKE 635  malo sina
CBI34727          566 MDLES-----KLERTHPLALLANELRLIANRELTVFCPILRHWCPEAGMISAMLLNQLYGERLKPFLKGVTS-LSEDVKL 639  wine grape
EEF51128          570 VDLEA-----KLQRVHPLALLAKELKLIAEREFNVFWPVLRQWCPESLMISIVLLHQFYGKRLKPFLKGVSS-LSEDVRS 643  castor bean
JCVI:AT4G11670.1  561 AYVKS-----HGERTHALALLANELTVIAKVEINEFVPVFSKWLPECMMISAMLLHRFYGERLTPFLEGVSS-LSGDVRK 634  thale cress
EEF33545          601 VLQRAG-----------KLEKFLVQMVVedSADCEDG-GKSIVREMVPF------EVDSVIMRVMKQWIEDKMKKGRECF 662  castor bean
EFJ38010          553 LLYAAD-----------NLEQYLLDLVT--SAENGDGkVAEYKAQMIPY------ELDKIPGNWSMRCITTKFEELSNGV 613  Selaginel...
XP_006594370      666 VFPAAE-----------SLEQFIMALIT--SVCHEEN-AEILLKKLNLY------QIEMKSGTLVLRWVNSQLGRILGWV 725  soybean
EEF49527         1088 VFPAAD-----------SLEQYIMSLIA----SGEGN-AEVNFRKLTPY------QVESISGTLVMRWVNSQLGRILGWV 1145 castor bean
Q8RX56            665 VFPAAD-----------SLEQYLLELMT--SVCGEDT-SGPYFKKLIPY------EVESLSGTLVLRWINSQLGRILSWV 724  thale cress
ERN19317          639 VLPAAD-----------ALDHYLMDLVH--SAHGKEMvNTSSGKDLHSY------QVGEISGPLILSWVDSQHDKMLEWI 699  Amborella...
XP_006652654      636 ILAATN-----------NFELYVADKLF---SMNEGAvGSWLSKYLKPY------MIVQFSSPLILQWLHAQHENVLEWT 695  malo sina
CBI34727          640 VLPAADifpvlgisvkyGLDNMKIRLELy---------SKSTSKKMKLFvlflcvQIGEISRPIILDWVIAQHGRILEWT 710  wine grape
EEF51128          644 VLPAAK-----------MLDDYLTQLHI--TALEANRsCHSSNQTLDHY------QIGEVSTPLILDWVISQHAHILEWT 704  castor bean
JCVI:AT4G11670.1  635 VVPAAY-----------MLQEELTQLYN---CHSKSKlRKPYFHKLKNY------EIEKAVKPVMLDWLISQHDHILQWT 694  thale cress
EEF33545          663 IRARDSE--TWNPKSKNEPYAQSVVELMKIAKETLDEFFEIPVGITDDLVCDLAEGLEHLFQEYIKFVE-ACGSKQSYVP 739  castor bean
EFJ38010          614 ESAFMEE--NWEPLSPEERYGRSASDIFKAIDKVVDSFFGIEFPIRASHIKNLIDALENAVQLYSDKLHkQLGDKADLIP 691  Selaginel...
XP_006594370      726 ERVIQQE--HWDPISPQQRHAGSIVEVYRIVEETVDQFFGLKVPMRFTELNSLFRGIDNALQVYANNVVnELASKEELIP 803  soybean
EEF49527         1146 ERAIQQE--RWEPISPQQRHGSSIVEVYRIVEETVDQFFALKVPMRPSELNGLFRGIDNAFQVYSNHVIeKLATKDDLIP 1223 castor bean
Q8RX56            725 ERAYKQE--HWDPISPQQRYGSSIVEVFRIVEETVDQFFALKVPMRSIELSALFRGIDNAFQVYTNHVMeKLASKDDLVP 802  thale cress
ERN19317          700 ERSCHLEvtDWEPLSSQQRQAASIVEVFRIIEETVDQFFGFKLPLETAHLKSLLGGIVRGLATYLQQVIsHLVEKNHLFP 779  Amborella...
XP_006652654      696 KRTIEME--DWEPLSAHEKHSTSVVEVFRIVEETIDQFFNSSLPLDTVHLRSLLIGITSSLQVYLHHMEnQQVPSATLLP 773  malo sina
CBI34727          711 GRAFDLE--DWEPLSSQQRQAVSVVEVFRIVEETVDQFFGLNLPMDITHLQALLSVIFHSLDTYLQKVIsELVEKSYLFP 788  wine grape
EEF51128          705 GRAFDIE--DWEPLSFHQRQAASIVEVFRIVEETVDQFFGLNLPMDITHLQALLSVIFHSLDAYLLKMLnQLVEKKHLYP 782  castor bean
JCVI:AT4G11670.1  695 RRAFEIE--EWEPLSVQQRHAASIVEIFRIIEETVSQLFGLHLPVDITHLQALLSLIYHSLDTYLQRVFdQLVDKKFLYP 772  thale cress
EEF33545          740 TLPPLTRCNRDSKFYKLWKKAT--PCSvgteemyqhggateahHPRPST--SRGTQRLYIRLNTLHYLLSHLHSldK 812  castor bean
EFJ38010          692 PAPALTRHKKEISIKVFSKRKVsdPHLp--------------dEKRSSElnALTTAKLCMRLNTLHFVLHQLNLlqe 754  Selaginella ...
XP_006594370      804 PVPILTRYKKEAGIKAFVKKELfdARVpe------------pdETRPSQisVLATPTLCVQLNTLYYAISHLNKleD 868  soybean
EEF49527         1224 PLPILTRYRKEAGIKAFVKKELfdSRLp--------------eETKSSEitVQATPILCVQLNTLYYAISQLNKleD 1286 castor bean
Q8RX56            803 PVPVLTRYKKETAIKVFVKKELfdSKHl--------------dERRSINidVPATAMLCVQLNTLHYAVSQLSKleD 865  thale cress
ERN19317          780 PAPALTRYKEPTM-KPFNKKKVieCKFl--------------eEEVEDQlnVLATSKICVRLNTLQYIGVQVNAleD 841  Amborella tr...
XP_006652654      774 SAPVLTRYTESMN--PFAKRKVivPTVp--------------eEKVANKldNLTVPKLCVKLNTLQYIRDQLDNiee 834  malo sina
CBI34727          789 STPSLTRYKEMVI--PIAKKKLveSTPl--------------dEKVNNKlnELTISKLCVRLNTLQYIQKQMRTleD 849  wine grape
EEF51128          783 SAPPLTRYTETAI--PVIKKRLleCALl--------------dDSINRKlnELTIPKLCIRLNTFQYIQKQIGIled 843  castor bean
JCVI:AT4G11670.1  773 SAPPLTRFTENVM--PVMKRKSleFSEp--------------dNKIVKKldELTIPKLCIILNTLCYIQKQISAtev 833  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap