Conserved Protein Domain Family
DUF809

?
pfam05663: DUF809 
Protein of unknown function (DUF809)
This family consists of several proteins of unknown function Raphanus sativus (Radish) and Brassica napus (Rape).
Statistics
?
PSSM-Id: 147685
View PSSM: pfam05663
Aligned: 4 rows
Threshold Bit Score: 225.437
Threshold Setting Gi: 323276509
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9B9L2     1 MITFFEKLSTFCHNLTPTECKVSVISFFLFAFLLMAHIWLSWFSNNQHCLRTMRHLEKLKIPYEFQYGWLGVKITIKSNV 80  radish
BAJ76672   1 MITFFEKLSTFCHNLTPTECKVSVISFFLLAYLLMAHIWLSWFSNNQHCLRTMRHLEKLKIPYEFQYGWLGVKITIKSNV 80  rape
Q9B9L4     1 MIPFFEKLSTFCHNLTPTECKVSVISFFLLAFLLMAHIWLSWFSNNQHCLRTMRHLEKLKIPYEFQYGWLGVKITIKSNV 80  radish
Q9B9L1     1 MITFFEKLSTFCHNLTPTECQVSVISFFLLAFLLMAHIWLSWFSNNQHCLRTMRHLEKLKIPYEFQYGWLGVKITIKSNV 80  radish
Q9B9L2    81 PNDEVTKKVSPIIKGEIEGKEEKKEGKGEiegkeekkegkgeIEGKEEKKEVENGPRK 138 radish
BAJ76672  81 PNDEVTKKVSPIIKGEIEGKEEKKEGKGE-------------IEGKEEKKEVENGPRK 125 rape
Q9B9L4    81 PNDEVTKKVSPIIKGEIEGKEEKKEGKGEiegkeekkegkgeIEGKEEKKEVENGPRK 138 radish
Q9B9L1    81 PNDEVTKKVSPIIKGEIEGKEEKKEGKGEiegkeekkegkgeIEGKEEKKEVENGPRK 138 radish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap